SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A7RS32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7RS32
Domain Number 1 Region: 216-393
Classification Level Classification E-value
Superfamily MIR domain 3.4e-39
Family MIR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 1086-1213
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-23
Family SPRY domain 0.021
Further Details:      
 
Domain Number 3 Region: 665-799
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000554
Family SPRY domain 0.036
Further Details:      
 
Domain Number 4 Region: 4191-4253
Classification Level Classification E-value
Superfamily EF-hand 0.0000000327
Family Calmodulin-like 0.08
Further Details:      
 
Domain Number 5 Region: 99-182
Classification Level Classification E-value
Superfamily MIR domain 0.000000732
Family MIR domain 0.024
Further Details:      
 
Domain Number 6 Region: 1542-1667
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000166
Family SPRY domain 0.024
Further Details:      
 
Domain Number 7 Region: 2258-2344
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000902
Family IP3 receptor type 1 binding core, domain 2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A7RS32
Sequence length 5101
Comment (tr|A0A0A7RS32|A0A0A7RS32_MYZPE) Myzus persicae clone 4106a ryanodine receptor mRNA {ECO:0000313|EMBL:AJA41114.1} OX=13164 OS=Myzus persicae (Green peach aphid) (Aphis persicae). GN= OC=Aphidomorpha; Aphidoidea; Aphididae; Macrosiphini; Myzus.
Sequence
MADSEGSSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCYLENIADKNIPPDLS
QCVFVIEQALSVRALQELVTAASSQEGKGGTGSGHRTLLYGNAILLRHQNSDMYLACLST
SSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTAK
ENELSVVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSSWSNVS
GQNIVIYEGGSVMSQARSLWRLELARTKWAGGFINWYHPMRIRHLTTGRYLGVNENNELH
LVCREEATTASSTFFLRQEKDDQKIILEDKDLEVIGAPIIKYGDSTVLVQHSDTGLWLTY
KSYETKKKGVGKVEEKQAVLHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFTQFISGL
ENLQSNRRSSLFCSFVNLNEMVMCLEDLINYFAQPEEDMEHEEKQNRFRALRNRQDLFQE
EGILNLILEAIDKVNIITSQGFMVSLAGDESGQSWDVISGYLYQLLAAIIKGNHTNCAQF
ANTNRLNWLFSRLGSQASSEGTGMLDVLHCVLIDSPEALNMMKDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASVRPNIFVGHVSGS
AVYRKWYYEVAIDHVEQTTHLNPHIRIGWANTAGYVPYPGGGEKWGGNGVGDDLYSFGFD
GSYLWTGGRKSEVMPGTQISNIKKSDVIGCALDLTIPIITFTLNGQLVQGAFRDFNLDGM
FFPVISCSSKVSCRFLLGGDHGRLKFTPPDEFSPLFETLLPQQILTIDPCFYFGNLNKCV
LTGPWYVEDDTAFVPNPVDTSMVTLPSYIENIKDKLAENIHEMWAMNKIEAGWQYGDKRN
DTRKYHPCLIQFDKLPPAEKRYDSQLAVQTLKTVIALGYHISIDNPPSRIKTVRLPNEPF
MQSNGYKPAPLDLSAIILSGKMEELIDQLAENTHNLWAKERIQQGWTYGLNEELQMLRSP
HLVPYSKVDDAIKKANRDTASETVRTLLVYGYNLDPPTGETNEATLLTDDNSNRYLTFRT
YRAEKTYAVSSGKWYFEFEILTSGPMRVGWARFTCSPGYQIGSDENSWAFDGYNEEKIYM
GTAESFGRQWQVGDVVGVFLDLMDHTISFSMNGELLMDTLGGETTFSEVQGEGFVPAFTL
GLGQKAKLTFGQDVNSLKYFTTCGLQEGYEPFCVNMKRPVTYWYTKDQPIFENTDDFSSV
IDVTRIPAGSDTPPCLKISHNTFETMEKANWEFLRLSLPVICLPSFIDDQEKQRRWQEIR
IRQHRLLSQSEHATPAHIEQIMKSGFSMSDIKGLHRGYSDDPVENDEIMPNTAPLPPRGK
NQPPPPRPPRKGSLSRHDDLTIENDGKLNRSSSELNFNIYNHQNGDGQDINKDDKKKRGR
SPFRFFSRKKEGPSDNPKRAKTPDPARNVDRSRNAAHRPNTLNERVTPQIRVSQMDLKLV
PPAIPDRPGGPKAMSFTPTSAGIEFVGNEIFDLECLKLINEYYYGVRIFPGQDPTHVYVG
WVTTQYHLHTKDFSQNHVRKSTVTIVDEHNRILESIDRQSCYMVRSDELYNEVTNDSSGK
AASQGMTIGCFIDIATGLMSFTCEGKETSFKFKMEPDIKLFPAIFVEASSKEILQIELGR
TSTTLPLSAAVLQNSERHVLPQFPPRLKVQCLRPHQWARVPNDSLHIHTLKLSDIRGWSI
LCEDPVSMIALHIPEEDRCIDILELIEMEKLLSFHAHTLTLYAAVCYQANYRAAHILCTH
VNQKQLLYAICSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYIIPLGHELTTLYDD
PQMGHSLRSLQTESVRPQMKMTEISDVIDNVRNLYSPYFPLQVVREYVMAALEEAVLVNQ
VHNRDPIGGSNENLFLPLLKLVDRLLLVGMLRDEDVEKLLIMINPETWDPEFQKDGPDEH
RKGLLHMKMAEGAKLQMCYLLHHLCDIQLRHRVESIISFSYQFVNDIQIDQLRRYNEIKQ
SDLPSAVAAKKTREFRCPPREQMNAILGFKNLDIDDKENCLIGDELRERMNEFNEKLMKQ
ISLVALQESEDDKSDLNNLNKEGKIKQFYNFINAVKDEANEDGLNEHEKKIPEEIFRKVL
ISTIVSWAEETQIETPKLVREMFSLLVRQYDSVGELIRALEKTYVINFKTKEDVAQMWVG
LSQIRSLLPVQMSQEEEELMRERLWKLVNNHTFFQHPDLIRVLRMHENVMAVMMNTLGRR
AQAQSQPGGTPVTGQDGEIVPKEKDTSHEMVVACCRFLCYFCRTSRQNQKAMFDHFSFLL
ENSNILLSRPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAIYLSRCGLQSNSELIE
KGYPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPECLGPALRGEGEGL
LRAIIDANKMSERITERRKFLEESGNQENIQLDHPLPESDDDEDYIDTGAAILNFYCTLV
DLLGRCAPDSSVISLGKNESLRARAILRSLVPLEDLHGVLSLRFTLQNPAAGQDRPKSDM
PSGLIPGHKQSIVLFLERVYGIEMQELFFTLLEEAFLPDLRTATMLDRNDGLESDMALAM
NRYIGNSVLPLLIGHSKFYSESDNYANLLDATLHTVYRLSKNRMLTKGQREAVSDFLVAL
TSQMQPSMLLKLLRKLTVDVSNLSEYTTVALRLLTLHYDRCAKYYGSTGGQGIYGASSDE
EKRLTMMLFSNIFDSLSKMDYDPELFGKALPCLSAIGCALPPDYSLSKNHDDEWYGSKQN
IQGPSDGPYNPQPINTNSIVLDNDLNSIVHKFSEHYHDAWANRKLENGWVYGEQFNDVNK
SHPRLKPYMMLSEYEKELYKEPVRESLKALLAIGWSIEHSENDAPLNNRGSVRRQSKSNE
NVTPFDYHPNPIDMTNLTLTREMQNMAERLAENSHDIWAKKKKEEVMLCGGGIHNQLVPY
DLLTDKEKKKDRERSQEFLKYLQYQGYKLHRPNRNGGPSEAEQLAAASTGELRFSYSLLE
KLIHYIDRASINMKLLKPSGTFSRRSSFKICTRDIKFFSKVVLPLVEKYFSTHRNYFITV
ATASSVLGAASLKEKEMVASLFCKLANLLRSKLMAFGADVRITVRCLQVLVKAIDAKSLV
KNCPEFIRTSMLTFFHNIADDLEHTIQNLHDSRYCYLRGTHLKTSTSLFYVNDVILPVLS
SLFDHLAAYEYGNELLLNEIQVAAYKMLSSLYTLGTDTSLTHDRKYLKVQLERHRPAFGS
CLGAFSSTFPVAFLEPHLNKHNQYSLLNRFADSSLEAQDIMSRMEGTMPTLETVLNEVDQ
FIESEKTYTDAPHIIDVILPLLCSYLPYWWAQGPDNVALTTGNHVTMVTSEHMNCLLKNV
LKLIKKNIGNDNAPWMTQIAAYTQQIIINSSEELLKDPFLPLAERVKKRTETLYHKEESL
RGFIKSSTDDTSQIEAQIQEDWQLVVRDIYAFYPLLIKYVDLQRNHWLRNNISNAEDLYN
HVSEIFNIWSKSQYFLREEQNFISANEIDNMILIMPTATRRSAVISETSLGGSTGKKKKK
HRDKKRDKEKEIQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRFLKRMPDYDVIQFV
KIQLTLPDKLDPADEMSWQHYLYSKLGSKKGTPEIKPQQVDEVADRIVAMAKVLYGLHMI
DHPQLQSKAIYRSVVSTQRKRAVIACFRQLSLHALTRHRAVNIFVRSFYELWLQDENIGQ
EVMIEDLTQSFEEAELKKRDKEEEEGMADPLNQMVTTFCRGAMTERSGALQEDPLYMSYA
DILAKSCGEEEEEGNNEEEGSTGNGEEEGGASIHEQEMEKQKLLFHQARLANRGVAEMVL
LHISACKGIPSEMVMKTLQLGIAVLRGGNLEIQMGMLNHLKEKKDVGFFTSVAGLMNSCS
VLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCTLFRFIQLTCEGHNLEWQNYLRTQ
AGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKELIDPAGKANFFKAIGVASQVFNTLS
EVIQGPCTQNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLLKELLNLQKDMITM
MLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFDMFLKLKDLTSSTSFTEIDPNNDG
WVHPKDFKEKMEQQKSYTAEEIEFMLQCCESNHDGKIDYIGFTDQFHEPSKEIGFNLAVL
LTNLSEHMPNEPRLTRFLETASSVLNYFQPFLGRIEILGGSKRIERVYFEIKESNIEQWL
KPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMQHASGLMAVDDGSGIGGGKSR
KTSYTYLADDEENKTAKDPIRRGIQAIKYGFHLLFFVLSPTNIKNKINEIQQMSVIELIT
SFFKLWFYLIFYTGYSGVYVLRYISRILMQLMSGTQSEETTVEVVEEKSGSFRMLPALPS
SGIDETPSTLTDSNNMRKNSGSLDSKHLKSTTGGDDKDETSAENHEKEDGVDGSELQASF
VDLLVGESARKDSIAGPEVLAQQQAVMAAVEAEIKQKNSVENPSAFSTIDINAYTHRALS
FLARNFYNLKYVALVLAFCINFILLFYKVTTLADDLSDDGDVKEFALGSAGISNDDIDDS
NSTEMADDDGALELVHVNEDFFYMAHVMRLAALLHSLASLAMLIAYYHLKVPLAIFKREK
EIARRLEFDGLYIVEQPEDDDIKSHWDKLVISAKSFPVNYWDKFAKKKVRQKYSETYDFD
SISNLLGMEKTSFSTQENEERTGLINFVINIDWRYQVWKAGVTITDNAFLYSLWYFTFSI
LGNFNNFFFAAHLLDVAVGFKTLRTILQSVTHNGKQLVLTVLLLTIIVYIYTVIAFNFFR
KFYVQEEDDEVDKKCHDMLTCFVFHLYKGVRAGGGIGDEIGSPDGDDYEVYRIMFDITFF
FFVIIILLAIIQGLIIDAFGELRDQLESVKEDMESNCFICGIGKDYFDKVPHGFDTHVQE
EHNLANYMFFLMHLINKPDTEYTGQETYVWNMYQQRCWDFFPVGDCFRKQYEEELGGGGG
V
Download sequence
Identical sequences A0A0A7RS32

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]