SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7RU41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A7RU41
Domain Number - Region: 119-155
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00785
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A7RU41
Sequence length 157
Comment (tr|A0A0A7RU41|A0A0A7RU41_9VIRU) Membrane spanning protein {ECO:0000313|EMBL:AJA42723.1} KW=Complete proteome OX=1567009 OS=Clostridium phage phiCT19406A. GN=phiCT19406A_33 OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA phages.
Sequence
MELVIIFYILFIIFFSALIIAALTGSKILKNKKDAIGVYSIGTVIYGVLFFLTLRLELSS
YNYIYMEPVSKTSINRKVSSKDDGNNFRAETPKEQLYVDENEKGKGLIKGNTSKKTGEKI
YHTPGSRYYNSTKIEDTERWFKTIEEAEKAGYRAPKK
Download sequence
Identical sequences A0A0A7RU41 A0A0A7RUL3 A0A1T4PK76 Q896C0
212717.CTC01088 WP_011099332.1.12609 WP_011099332.1.27827 WP_011099332.1.49058 WP_011099332.1.81004 WP_011099332.1.83101 WP_011099332.1.96257 gi|28210789|ref|NP_781733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]