SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7RXR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7RXR9
Domain Number 1 Region: 53-178
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 2.09e-43
Family Insert subdomain of RNA polymerase alpha subunit 0.00000116
Further Details:      
 
Domain Number 2 Region: 7-53,179-233
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 4.12e-29
Family RNA polymerase alpha subunit dimerisation domain 0.000048
Further Details:      
 
Domain Number 3 Region: 251-325
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 4.45e-25
Family C-terminal domain of RNA polymerase alpha subunit 0.00000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A7RXR9
Sequence length 329
Comment (tr|A0A0A7RXR9|A0A0A7RXR9_9GAMM) Transcriptase subunit alpha {ECO:0000256|HAMAP-Rule:MF_00059} KW=Complete proteome; Reference proteome OX=1267021 OS=Frischella perrara. GN=FPB0191_00182 OC=Frischella.
Sequence
MQGSVTEFLKPHLVEVVQYNQTHAKVILEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDVLDILLNLKKLAVKVHSKDDVMLTLNKSGAGVVTANDIIHDGD
VEIVNPDLVICHLTDANASISMRIRVQRGRGYVPASARVRSEDEERPIGHLLVDACFSPI
DRIAYSVEAARVEQRTDLDKLVIDMETNGTIDPEESIRRASTILAEQLEAFVDLRDVRQP
EVKEDKPEFDPILLRPVDDLELTVRSANCLKAEAVHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIVED
Download sequence
Identical sequences A0A0A7RXR9
WP_039103350.1.21977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]