SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A7XDM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A7XDM5
Domain Number 1 Region: 11-100
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.12e-16
Family Intron-encoded homing endonucleases 0.0079
Further Details:      
 
Domain Number 2 Region: 104-159
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000628
Family GCC-box binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A7XDM5
Sequence length 165
Comment (tr|A0A0A7XDM5|A0A0A7XDM5_9CAUD) HNH homing endonuclease {ECO:0000313|EMBL:AJB43746.1} KW=Complete proteome; Reference proteome OX=1458848 OS=Escherichia phage Bp4. GN=EpBp4_0042 OC=G7cvirus.
Sequence
MKQRIAHDRLLQLVSYDPISGIFTRRNTGKVSGYLMKSGYVQLRVDSVLYYGHILAWFYV
HGVWPTDRIDHKDNIRHHNWIDNLREATHKQNNQSAVLSKTNTSGFKGVSFSKNLGKYRA
TIWVNSKPITLGFTDDPREAAVLYDEAAITHYGEFAKTNKQLGLL
Download sequence
Identical sequences A0A0A7XDM5 J9SSY0
gi|410492010|ref|YP_006908817.1| YP_006908817.1.16875 YP_009113223.1.37058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]