SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A8DY18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8DY18
Domain Number 1 Region: 744-959
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.24e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 
Domain Number 2 Region: 63-214
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000424
Family Pyruvate oxidase and decarboxylase Pyr module 0.065
Further Details:      
 
Domain Number 3 Region: 458-646
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000191
Family PFOR PP module 0.043
Further Details:      
 
Domain Number 4 Region: 287-412
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000288
Family Transketolase C-terminal domain-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A8DY18
Sequence length 1240
Comment (tr|A0A0A8DY18|A0A0A8DY18_9XANT) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:AJC46623.1} KW=Complete proteome OX=56458 OS=Xanthomonas sacchari. GN=SB85_13585 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MNRIADPRPSSSLAAAAADGVDTRYTLEDKYTRTDGRIYLSGVQALVRLPLMQQLRDRAA
GLNTGGFVSGYRGSPLGGFDLELWRARKHLDAANVVFKPGLNEDLGATMVWGTQQTNLFP
GARVDGVYAMWYGKGPGVDRCGDVFKHGNAAGTSRHGGVLALAADDHACRSSTLPHGSED
EFVSAMMPVLNPAGVQDILDMGLLGWAMSRYTGRWIGFKTIAETVESSASVQVDPFARQI
VLPEDFELPPGGLNIRWPDPPLDQEMRLHRYAVRAAQAFARANGIDRTVMDAPQARLGIV
TTGKSYLDVLQALEYLGLDADACARIGIRVYKVGMTWPLEPLGIAAFARGLQDIVVVEEK
KAFIERQMKEQFYNWPASAGPRPSIVGKYDEAGEWILPSTGELTPATIAGVIGRRILRLP
QSAAVNTDSIEQRLRWMEAKEAEMALPRANFPRVPHYCSGCPHNTSTVVPQGSRALGGIG
CHYMVTWMDRATDTFTHMGGEGVTWAGQAPFTDTPHVFQNLGDGTYFHSGSLAIRQSIAA
GVNITYKILYNDAVAMTGGQPVDGTLSVPDIARQMRAEGVHTIALVSDDIGKWTRRRELF
PSDVDFHDRSELDAVQRHLREVKGTSVLIYDQTCATEKRRRRKRGKLPDPPKRVLVNSLV
CEGCGDCGEKSFCVSVLPKETEYGRKRQIDQSSCNKDYSCVSGFCPSFVTVHGGQPRKGR
KADAAALLEQLPTPSFRSDLRQPWNILITGVGGTGVVTIGALLGMAGHLEGKGASVLDQT
GLAQKGGAVTTHIRIARQPEDLHAVRIAAGEADLVLGCDMVVVNDYWALSKVRGDRSQVV
LNSYEAMPGTFTTHPDMQFPAAEIIAGVRLALGGRDPLLLDATQLATALLGDAIASNLFM
LGYAWQQGLVPLSHAALMRAIELNGAAVAMNQQAFAWGRLAALDLPAVRRAAGLADPAAD
ERERQAPGLQQLPPGEWEGHEAGASAAPRNPANPRPARELPAAAESGEAGHAPLDDSRLS
RSLPELVARRHAFLVDYQDAAYAARYTALVERVRAAEQRVAPASTALTEAVARYAFKLMA
YKDEYEVARLYTSGAFAQQLQAQFEGDYRVRFHLAPPLLAKKDAQGRLRKREYGPWMFTA
FKWLAKLRRLRGGTFDVFGYSAERRGERQLIADYLATVDELLHRLQADNLALAVQIASIP
EHIRGYGHVKEAHLHEAKQQEARLLATWRNPKALHIVQAA
Download sequence
Identical sequences A0A0A8DY18
WP_043094052.1.48363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]