SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A8GGW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8GGW3
Domain Number 1 Region: 175-359
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.49e-72
Family Methylesterase CheB, C-terminal domain 0.000000513
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily CheY-like 2.85e-26
Family CheY-related 0.0000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A8GGW3
Sequence length 365
Comment (tr|A0A0A8GGW3|A0A0A8GGW3_RHIET) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1432049 OS=Rhizobium etli bv. phaseoli str. IE4803. GN=IE4803_CH03875 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MAKKIRVLIIDDSASIRQTLTHVLEQDPDIEIMAVASDPFVAARKLLEEVPDVITLDVEM
PRMDGITFLRKLMAQRPIPVVMCSSLTEAGSQTLIQALEAGAVDVILKSKIGAADSLSDD
AIRIREIVKSASHARLTTVRRAAGTIRSASADGPTKKLTADAMLPPPTGRAMAKTTEMVV
CVGASTGGTEALREFLEELPANAPGMVIVQHMPERFTDAFAKRLNGLCEVEVKEAVDGDP
VLRGHVLIAPGDKHMLLERQGARYHVSVKTGPLVSRHRPSVDVLFRSAARSAGSNAMGII
MTGMGDDGARGMLEMHQAGAYTVAQDEASSIVFGMPKEAIARGGVDRVLPLDQIAREVMM
TQQKF
Download sequence
Identical sequences A0A0A8GGW3
WP_039622110.1.39331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]