SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A8L2C2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8L2C2
Domain Number 1 Region: 289-475
Classification Level Classification E-value
Superfamily MIR domain 4.19e-27
Family MIR domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A8L2C2
Sequence length 629
Comment (tr|A0A0A8L2C2|A0A0A8L2C2_9SACH) WGS project CCBQ000000000 data, contig 00041 {ECO:0000313|EMBL:CDO92349.1} KW=Complete proteome OX=1427455 OS=Kluyveromyces dobzhanskii CBS 2104. GN=KLDO_g669 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
Sequence
MNVRVSKEGRFKSYIAHDYQSYIKRDLLPYEKSLIWDLVLSALVVGYLSLTHLSRRNDIS
NSEIELWNQVTERIEGKFFISASVPTLIEVASKVSDFYSLGIDFWKTANNVVLATTLVNI
YRILRHSNVSVLISFGAAAMFSQVSSFQDLIYRFNLESYHLLAISLVILHWRKFQASRDF
SISWFVNITLLSMSLVFVTGGKFIGIVSYAWLLVVSLKSIWTIVGDIDVKNGQLFAHTCF
RLLFFVIVPSASLVYSYFSLIERFEITSDSIVYMTSSFQHYTVGLHNDLPSSINYESVIR
IRHVESLDGYLSSLDIAYPNSNDTMVTISDDPFDEASMWTVESRRKSNSDGNLSSLTVKQ
TEKVKLRNKKTGQLLRASEAKPPISDKEYDKRISTTGDSTYEGDQDELWKFEIQGKSSFR
ETVAPFKHYFMLKNPARHCSLLSHDIRMPRWADRRQEVLCVEPATVNRALFYIDFVSSPE
GIAVDAYEWPAEYPFYKMLYEYVTSQFRLDKKQNLDNTSMSPPDPLTWPILFDDRNQIGK
ILRILSTVSVVVYVLIEGYSWLTWNLFEDNLSNITASKLMKKEVAFEAFLGWFLHLCVFS
YSSHSNLSVNQYLPSLLFAVILLSQLSVV
Download sequence
Identical sequences A0A0A8L2C2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]