SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A8L854 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8L854
Domain Number 1 Region: 4-261
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-62
Family Capz beta-1 subunit 0.00000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A8L854
Sequence length 279
Comment (tr|A0A0A8L854|A0A0A8L854_9SACH) WGS project CCBQ000000000 data, contig 00106 {ECO:0000313|EMBL:CDO94282.1} KW=Complete proteome OX=1427455 OS=Kluyveromyces dobzhanskii CBS 2104. GN=KLDO_g2555 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
Sequence
MSVDEKFDAACELLYRLDPTKVKSHLQSLIALEPEIAEGLLSTIDVPLTVKKDSDSNNKE
FLCCDYNRDIDSHRSPWSNTYFPELSAKDLEESPFPSEPLRALELACNNSFELYRDLYYE
GGITSTYLWDVDESTDFAGIILFKKAESEDAKWDSIHVISATNDEDGNQVTYNVTTTVIL
HLENLSKEQQLSLSGNLTRETSKTVKLRNVSTVEQLVHAHSSNLGSMVEDIESKLRSMLE
VVYFEKTLDIYNVLRESNDASTKLQKEQHSELIENFQKL
Download sequence
Identical sequences A0A0A8L854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]