SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A8LCV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A8LCV1
Domain Number 1 Region: 2-256
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.84e-69
Family Capz alpha-1 subunit 0.0000894
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A8LCV1
Sequence length 262
Comment (tr|A0A0A8LCV1|A0A0A8LCV1_9SACH) WGS project CCBQ000000000 data, contig 00015 {ECO:0000313|EMBL:CDO95963.1} KW=Complete proteome OX=1427455 OS=Kluyveromyces dobzhanskii CBS 2104. GN=KLDO_g4185 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
Sequence
MSDFEKIVRDIVFDSPVEEISLVYDNLQVLSDGESKQQIVSIIQDFNEKYRVPVTSGKDR
YIVSEYNKSGSKYYDPLNKVIFSVDHITREVSDLKDYTDADSTDEQLKLADQLSTYVSKF
FPDTAAYNVFKIPDSDKLTVVIVSNKKSLGDFWTGYWLSEYIYDVKEGTITGDISVDAHY
FEDGNVRFKSSAALKPTNTDSPVVDIKQFEKQFENNLIEKFQYMNATQFKGLRRRLPVTR
AKINWGQGIGNYRLGRDAAQDA
Download sequence
Identical sequences A0A0A8LCV1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]