SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A8NW05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0A8NW05
Domain Number - Region: 5-79
Classification Level Classification E-value
Superfamily MIR domain 0.017
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A8NW05
Sequence length 188
Comment (tr|A0A0A8NW05|A0A0A8NW05_XENNE) Uncharacterized protein {ECO:0000313|EMBL:CEF32617.1} KW=Complete proteome OX=1437826 OS=Xenorhabdus nematophila str. Websteri. GN=XNW1_4410028 OC=Morganellaceae; Xenorhabdus.
Sequence
MSNVILYGDVLHIKNEYGNGSYLDTYGHANSLGEKYNVVTSVSPNRDTGSGSWQILSAEG
KSLGTAVCSSDIVFLLNSYLNNGGYLRVSGNAPSPELYNVYTADRPIYSLDTAIWHLFSD
TTHEFDGKVREGNIIRLLNNFNQIQGGFLDTCWTSEHPGTIYKVYTSLLSNRDSGSGIWT
LSKSSNKK
Download sequence
Identical sequences A0A0A8NW05 A0A0R4FQP7 D3VBY6
WP_013185382.1.22819 WP_013185382.1.61374 WP_013185382.1.95391 gi|300724738|ref|YP_003714063.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]