SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0A9WDJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9WDJ1
Domain Number 1 Region: 216-393
Classification Level Classification E-value
Superfamily MIR domain 1.7e-37
Family MIR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 1088-1217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-21
Family SPRY domain 0.026
Further Details:      
 
Domain Number 3 Region: 665-802
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000241
Family SPRY domain 0.07
Further Details:      
 
Domain Number 4 Region: 99-182
Classification Level Classification E-value
Superfamily MIR domain 0.00000017
Family MIR domain 0.024
Further Details:      
 
Domain Number 5 Region: 2260-2342
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000732
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0A9WDJ1
Sequence length 3064
Comment (tr|A0A0A9WDJ1|A0A0A9WDJ1_LYGHE) Ryanodine receptor 44F {ECO:0000313|EMBL:JAG05456.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_98488 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MGDTEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
TCVFVIEQALSVRALQELVTAAGTEEGKGGTGSGHRTLLYGNAILLRHQNSDMYLACLST
SSSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTK
ENDQSIVNASFHVTHWSVQPYGTGISKMKYVGYVFGGDVLRFFHGGDECLTIPSTWSQDA
SQNVVVYEGGSVLSQARSLWRLELARTKWSGGFINWYHPMRIRHLTTGRYLGVNEANELH
LVPREEATTALSTFILRVEKDDQKVVMEDKDLEVIGAPIIKYGDTTVLVQHCESGLWVTY
KSFETKKKGVGKVEEKQAVLHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFHKFIKGL
EELQLNRRHSLFCATVNLNEMVMCLEDLINYFAQPEEDTEHEEKQNRLRALRNRQDLFQE
EGILNLILEAIDKINVITSQGFLVNLAGDESGHSWDIISGFLYQLLAAIIKGNHTNCAQF
ANTNRLNWLFSRLGSQASGEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTQLVDHVASVRPNIFVGRVEGS
AVYQKWYFEVTLDHMEQTTHMTPHLRIGWANTAGYVPYPGGGEKWGGNGVGDDLYSFSFD
GSALWTGGRKTVVLLNNNAPNGPFIRKGDVIGCALDLTVPAIRFTFNGAPISGCFTNFNL
EGMFFPCISCSSKLSCRFLLGGDHGRLKYAPPEEFSPLVESLQPQQVLSIDPCFYFGQLS
KTILSGPFPIESDTAFVPVPVDTTSVSLPNLVETIRDRLAENIHEMWAMNKIEAGWIFGE
LRDDIRRVHPCLVQFEKLPAAEKRYDTQLAVQTLKTIIALGYHITVDKPPSRIKNVRLPN
EPFLQPNGYKPAPLDLSAISLTPKMEELVDQLAENTHNLWAKERIQQGWTYGLNEDPDYC
RSPHLVPYCKVDELIKKANRDTASETVRTLLVYGYNLDPPTGEQTEALLAEAGRLRQMSF
RTYRAEKTYAVTSGKWYFEFEILTAGPMRVGWAAADCPPGHQLGADDHSWAFDGYNEEKV
TSGVAESFGRQWTVGDVVGVFLDLLDHTISFSLNGELLMDTLGGETTFGDVQGEAGFVPA
FTLGVGQKARLVYGQDVNALKFFTTCGLQEGYEPFCVNMNRQVTYWYTKDQPIFENTDDY
ADTRIDVTRIPPGSDTPPCLKVSHNLFETMEKANWEFLRLSLPVICESTFIDENEKIRRW
KEIRMRQQRLMNEAEQQYTTNAQMEQIMRSGFSMSDIKGLTSYPEDAVESDEVMGRSLPA
RNAKGQPPAPPRPPRKGSLSRPDDVIMNGTMESGIGAMNRSTSELDFNRYNGELSDSDKS
QKKRGRSPFRFFSRKNRDTSGSAERPKKGRTPEPQMLEPQVTPTLQRGGLRATKGPGDMK
PPSPLAERTNKGGGMSMSVPAASGIETVGNEMYDAECLKLINEYYYAVRIFPGQDPTHVY
VGWVTTQFHQHAAHFNQNCVLKSTVTVEDSYNRVFDRIERQNCYVVRADELYNEVTQDAS
GKSASQGMIIGCSIDTATGYITFTCEGKDTKHKYRMEPETKLFPAIFVEATSKEILQIEL
GRTSTTLPLSAAVLRNSEKHVIPQFPPRFKVQCLIPHQWARVPNVSLHVHALKLSDIRGW
SMLCEDPVSMIALHIPEEDRCIDVLELIEMEKLLSFHAHTLGLYAALCFQSNYRAAHALC
HHVDQKQLQYAIRAEYMSGPLRRGFYDLLIALHIESHANTMEICKNEFIIPLGPELKELY
EDPDMGNSLKSLQAVSVVPNMKMSDIVIESTENIQTLYSPYFPLDAVRDYVMVALHEAVE
ISQVHNRDPIGGSNENFFLPLLKLTDRLLLVGMLRDEDVMKLLIMFDPETWDPTFEKEGK
DEHRKGLLQMKMAEGAKLQMCYILQHLCDIQLRHRIEQIIAFSFDYCGEIQNDQLRRYIE
IKQTDLPASVAAKKTREFRCPPKEQMNAIISFKNLEEDDEACPVGTELKEKLNGFHEQLL
VKVSLSALQEPQEEEEETDANKPGMFKKMYNFINRVKELDEPPKVEPEPEKKTPEEVFRK
VLIKTIVRWAEEHQIETPKLVREMFSLLVRQYDTIGEIMRSLKTTYAINYKTRDDVALMW
VALSQIRALLPVQMSHEEEALMRMRLKKFVNNHTFFQHPDLIRVLRVHENVMAVMINTLG
RRSQAQSDTPQTGEGGEPVAKEKDTSHEMVVSCCRFLCYFCRSSRQNQKAMFDHLAFLLE
NSNILLSRPSLRGCTPLDVAYSSVMENTELALALREHYLEKIAIYLSRCGLQSNSELVEK
GYPDLGWDPVEGERYLDFLRFCVWVNGESVEENSNLVIRLLIRRPECLGPALRGEGEGLL
QAIIEANKMSERLQDRRKMMDEGQDLTGFEHPLPESDEDEDYIDTGAAILAFYCTLIDLL
GRCAPDASVIAQGKNESLRARAILRSLVPLEDLFGVLSLRFTLTHPAVGEVAPISDIPSG
LIPSHKQSIVLFLERVYGIESADLFFRLLEEAFLPDLRAATMLDKADGGESEMALAMNRY
IGNSILPLLISHSNFYGNADNYASLLDATLHTAYRMSKNRMLTKGQREAVSDFLVALTSQ
LQPNMLLKLLRKLTVDVSQLSEYTTVALRLLTLHYDRCGKYYGMSGQGGSSDEEKRLTMM
LFSNIFDSLSKMDYDPELFGKALPCLTAIGCALPPDYSLTKNYDDEWEANSGESSNAQYN
PQPINTSSVSLSNDFNTIVQKFSEHYHDAWASRKMENGWQYGEQWSDSSKTHPRLKPYTM
LSDYEKERYKEPVRESLKALLAIGWGVEHTEVDIPSNNRGNSVRRQSKGAMGEAGSPFSY
HPNPIDMSNLTLSREMQNMAERLAENSHDIWAKKKKEELNHWEEPCRPSLCPTTYSQIKR
RKKIEKGPRSSSSTCNIKDSNFTNPTVVETKQIKLPLLQLPENPGSLTVFSKNFYNTRTR
LPST
Download sequence
Identical sequences A0A0A9WDJ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]