SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9X738 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9X738
Domain Number 1 Region: 4-48
Classification Level Classification E-value
Superfamily BEACH domain 0.0000314
Family BEACH domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0A9X738
Sequence length 179
Comment (tr|A0A0A9X738|A0A0A9X738_LYGHE) BEACH domain-containing protein lvsA {ECO:0000313|EMBL:JAG15461.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_48833 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MFQRMTYGEDVVAALQQAITPHDCDVIIAEVDNFGQVPVQLFQERHPAHYELAPIKNKDG
VGNTNTATAVTSIHKFTKQSSTVGVGKSSSVVDPPNDSGGTVLGSGHTYTLTFEAHMPKT
IPMLVHAHDIPQLCFTLQEIWPGLLHLLPSLIMETFGLHTDACALHRVGNKTSSSSSSS
Download sequence
Identical sequences A0A0A9X738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]