SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0A9Y759 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0A9Y759
Domain Number 1 Region: 145-301
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-33
Family MAM domain 0.009
Further Details:      
 
Domain Number 2 Region: 31-81
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000417
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 309-349
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000575
Family Somatomedin B domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0A9Y759
Sequence length 376
Comment (tr|A0A0A9Y759|A0A0A9Y759_LYGHE) Uncharacterized protein {ECO:0000313|EMBL:JAG25375.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=CM83_45647 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MNGNDCLLLLFYLLIAVNISPYSCLPRRNNRCTSIPVPNGKMTVRHRGRVGRFFCNTGYK
LIGDKIATCHGGVWDTVPHCVKDIECPQQMPKVMNGKMVPFNYVFFKVVCNPGFMVPHEI
QSIFPCEDFFNPDMKPPVCQLTDEQFCDFETDMCKWNNTVPYFSWIRYQNATPSHSLRTG
PEGDHTYGTGHYLYIEASGLPSNEERFAKLVRRFWKVDTPEVCFVFWYHMYGFSIGTLDV
YVDYVKVFTKTGNLGDKWRKGIVQNLPSDRDFYISMVATTGNGYAGDIAIDDIGLVNSTD
CTKIFLIETSCKDRCFEVETNSTLCKCSSECLIEANCCPDFMQTCGADAPQSTTSAELSE
STYESYQTVSQDGKLI
Download sequence
Identical sequences A0A0A9Y759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]