SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B0IBD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B0IBD1
Domain Number 1 Region: 256-445
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.83e-60
Family Methylesterase CheB, C-terminal domain 0.00000606
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 4.84e-30
Family CheY-related 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B0IBD1
Sequence length 448
Comment (tr|A0A0B0IBD1|A0A0B0IBD1_9BACL) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=1472719 OS=Paenibacillus sp. P1XP2. GN=CM49_00547 OC=Paenibacillus.
Sequence
MAPYKVLVVDDSAFMRKIFSDLIEKDPAFQVVDTAVNGREAVEKAVGLKPDIVTMDVEMP
EMNGLEALKLIMAKQPMPVIMLSGINEEGMKETIKALESGAFDFIRKPSLTYSQDIGQVG
DALLVQLKAAMAAKERRAAFEAEEGKRRLQKETLRPYTPPGGAVVESKKAASEPLKRPLP
PPAVKQETPLEKTGRRMKEPKKAKPEAPPPVIVAETAAAREYNAASAPLEERREKRNEKR
HEQRNEKRSGVRHAFNDIVAIGCSTGGPRALKEVLEHIPADLPAPVVIVQHMPPNFTRSL
AQRLNSFSPLEVMEAEDGMKLQAGSAYIAPGGKHLRIVRDADGSLITSLSDDKPLNGHKP
SVDVLFESLLPLDSLERHVVLMTGMGSDGAKMMKRLYDAGVKSTFAESEETCVVYGMPRS
AFELDCVSHVLPLQDIAAGVVRAVGHGK
Download sequence
Identical sequences A0A0B0IBD1
WP_036706944.1.43715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]