SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B0ML40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B0ML40
Domain Number 1 Region: 34-210
Classification Level Classification E-value
Superfamily MIR domain 1.44e-55
Family MIR domain 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B0ML40
Sequence length 219
Comment (tr|A0A0B0ML40|A0A0B0ML40_GOSAR) Uncharacterized protein {ECO:0000313|EMBL:KHG01107.1} KW=Complete proteome; Reference proteome OX=29729 OS=Gossypium arboreum (Tree cotton) (Gossypium nanking). GN=F383_22218 OC=Gossypium.
Sequence
MAMGFFGLALFLFLAFDFDQGSPSSASAASSSSSQNVQVTYGTVLKLMHEKTKFRLHSHE
VPYGSGSGQQSVTGFPNVDDSNSYWIVRPPPDTSAKQGDTIPDGAIIRLQHMRTRKWLHS
HLHASPISGNLEVSCFGGESESDTGDYWRLLIEGSGKSWKQDQRIRLQHIDTGGYLHSHD
KKYARIAGGQQEVCGVREKRADNVWLAAEGVYLPITESK
Download sequence
Identical sequences A0A0B0ML40
XP_017627702.1.75545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]