SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B0NVU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0B0NVU9
Domain Number - Region: 54-87
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00458
Family B-box zinc-binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B0NVU9
Sequence length 238
Comment (tr|A0A0B0NVU9|A0A0B0NVU9_GOSAR) Salt tolerance-like protein {ECO:0000313|EMBL:KHG15211.1} KW=Complete proteome; Reference proteome OX=29729 OS=Gossypium arboreum (Tree cotton) (Gossypium nanking). GN=F383_03320 OC=Gossypium.
Sequence
MKIQCDVCERAPATVICCADEAALCAKCDIEVHAANKLASKHQRLLLQCLSNKLPPCDIC
QEKAAFIFCVEDRALFCRDCDEPIHPAGSLAANHQRFLATGIRVALSSSCNKNTENNVLE
PPNKSAPQTSMKMPAHQQHSSFSSPWAVDDLLELSDIQSLNKKEHSELGELEWLADIGLF
GDQLPQEALAAAEVPQLPISQSSSTNLYRPTKYSMALKKPRIETPDEDDEFFTVPDLG
Download sequence
Identical sequences A0A0B0NVU9 A0A0D2T2Y8 A0A1U8PA90
XP_012487043.1.20347 XP_016670516.1.88148 XP_016748117.1.88148 XP_017610998.1.75545 Gorai.006G229300.1|PACid:26830484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]