SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1P3I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1P3I7
Domain Number 1 Region: 13-115
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 8.11e-25
Family Steroid-binding domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B1P3I7
Sequence length 121
Comment (tr|A0A0B1P3I7|A0A0B1P3I7_UNCNE) Putative progesterone binding protein {ECO:0000313|EMBL:KHJ31895.1} KW=Complete proteome; Reference proteome OX=52586 OS=Uncinula necator (Grape powdery mildew). GN=EV44_g4814 OC=Erysiphales; Erysiphaceae; Erysiphe.
Sequence
MSTRFEPKTPVNLAPPKSDPITLTELRKANGNDSNLCYVAIKGKVFDVSGNKAYLPGGPY
HNFAGHDASRALALTSTKIEDVRHEWEDLGEKEKEVLNDWMTYFSKRYNVVGVIQKSDSE
A
Download sequence
Identical sequences A0A0B1P3I7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]