SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B1P461 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1P461
Domain Number 1 Region: 329-530
Classification Level Classification E-value
Superfamily MIR domain 8.2e-59
Family MIR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B1P461
Sequence length 887
Comment (tr|A0A0B1P461|A0A0B1P461_UNCNE) Putative dolichyl-phosphate-mannose-protein mannosyltransferase {ECO:0000313|EMBL:KHJ33068.1} KW=Complete proteome; Reference proteome OX=52586 OS=Uncinula necator (Grape powdery mildew). GN=EV44_g1647 OC=Erysiphales; Erysiphaceae; Erysiphe.
Sequence
MTCETASEKASSVKDDRKAEVQLPSKLIANYRSEGVDDHDIFLLPSSDYQLMLGVTLLAI
FIRLFRIYQPSSVVFDEVHFGGFVSKYIKGSFFMDVHPPLAKLLLTLAGWLAGFDGNFTF
KEIGMDYIEPAVPYVAMRMLPAICGILTVPIIFLTLKAAGCHTFSATMGAILITFENGLL
TQARLILLDSPLVFMTTITVLAFISFSNQHEQGPKKAFQPTWWFWLIMTGVGLGATVSVK
WVGLFTIGWVGSITIVQLWVLLGDVNNVSPRIFAKHFLARVLCLIIIPVSFYMMMFVIHF
ISLVNPGDGDGFMSSEFQSTLNSKAMQDVPADVAFGSQLSIRHYNTQGGYLHSHNLMYPT
GSKQQQITLYPHKDENNIWLLENMTQPLDNKGRPINGSQAWNNIVPPVYVKNGDIIKLLH
LQTGRRLHSHDIRPPVTETDWQNEVSAYGYEGFDGDANDYFRVEIIKKLSKGEEAKVRIR
TIQTKFRLIHVMTGCVLFSHKVKLPDWASEQQEVTCAKGGTLPNSIWYVEQNHHPQLGEF
AEKVNYQKPDFFAKFWEVQKVMWNTNAGLVESHAWDSRPSSWPILQRGINFWGKDHRQIY
LIGNPVIWWSSTLAILSYIAIKGIAILRWQRGYQDYNCVIFKRFDYEIGTIVLGWAFHYF
PFYLMQRQLFLHHYFPALYFAILALCQIFDFSTNRIGKFVRRELIIIGRLGAIVFLALSF
VAFWVYSPLAYGNPWTQSACRKAKLFDSWDWDCNTFLTEYSQYSLHSLSYQNALRTEVAP
VQLASSDAIPVPELNKKQNPIVDQKPAIVKKHKILSDAPDFKSQKALKPGQSIISREKKI
EYRDQAGNILNEEQVKSFRGKVDFKTRYETRTRLIDAQGVEIISPDS
Download sequence
Identical sequences A0A0B1P461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]