SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B1Q340 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1Q340
Domain Number 1 Region: 716-927
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.29e-26
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 
Domain Number 2 Region: 16-197
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000177
Family Pyruvate oxidase and decarboxylase Pyr module 0.037
Further Details:      
 
Domain Number 3 Region: 435-619
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000124
Family PFOR PP module 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B1Q340
Sequence length 1159
Comment (tr|A0A0B1Q340|A0A0B1Q340_9RHIZ) Indolepyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KHJ53786.1} KW=Complete proteome; Reference proteome OX=370622 OS=Aureimonas altamirensis. GN=LA66_14365 OC=Aurantimonadaceae; Aureimonas.
Sequence
MASDELDRKYSAREGRVFMSGTQALVRLPMVQMRRDREAGLNTGTFISGYRGSPLGGYDQ
HLMKVRRELEAEGIVFKPGVNEDLAATAVWGSQQASVSPGFRKDGVVGIWYGKGPGVDRS
GDVFKHANAAGSSRHGGVLAIAGDDHGAKSSTVPHQSDHAFMAAVMPMLYPSSIHEFVEF
GLAGIAMSRYSGCWVGMKVIADTVETTASVDLSGERRIFVEPGDFQLPADGLNLRVPDDR
WAQDNRLQTYKAYAAIAFARANRLDRVTLDSEDARLGIIASGKAYEDVRQALKELGIDEE
TAHRARLRLYKVGMPWPLEPEGVREFSVGLEEILVVEERREIIENQIKQQLFNWRADVRP
RIIGKFDHKDRPVLSLAEELSVATAAITIGEHILAMGHVDPDHRAYIEARIAHFRRRRDA
GKQAVAPVARMPFYCSGCPHNSSTKVPEGSRGMAGIGCHFMVTWMGRSSETFSQMGGEGV
AWAGIAPFTDEKHVFVNLGDGTYFHSGILAIRQAVAAGVNATYKILFNDAVAMTGGQKVD
GHLDPVQITHQLEQEGVSPIYLVSETPDRYAPAQLPHGAIIRPRDEVEAVMREIREAPGV
SAIVYDQTCAAEKRRRRKRGLMPEPNRRVAINPAVCEGCGDCSVQSNCISVEPLETEFGR
KRRINQSSCNKDFSCLKGFCPSFVTLEGAEPRRRAALGGPDLSSVPEPVVPELEDVCNIA
ITGVGGTGVLTIGALLGMAAHLDGKAPMLLDMAGLAQKGGAVLSHVRLGRRAEDVTCPRI
VSGSTDLLIAADDVVAASKESVNLLSSERTRAVVNTHLTPVAQFVRDPDFDFRRTLVSGT
IGKSVMPGSHFENFTEMAERVAGDAIATNIMMLGYAWQKGLVPLSGNAILEAIRINGVAV
KANLDAFGWGRLAAAEPQRIAALAGDGQPPVETLADMTTERLIEHRAAMLADYQDAALAR
RYRDLVSRAEVADASAGAHGKLVRAVAHNYAKVLAYKDEYEVARLFTDGRFADSLKRDFT
GVKRMTFHMAPPFLSGTDSNGRPRKRNFGPWILPVMRLLAKGKRLRGSALDPFGYGAERR
EERAAIATYEADCDMVFQRLEAGNLGIAVELLSLPDSVRGFGPVKAAGAVAAAARRASLT
QTLLEARQADKPRLPEPAE
Download sequence
Identical sequences A0A0B1Q340
WP_039194615.1.73204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]