SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1S0V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1S0V6
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 1.8e-19
Family Transcriptional factor tubby, C-terminal domain 0.0000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B1S0V6
Sequence length 107
Comment (tr|A0A0B1S0V6|A0A0B1S0V6_OESDE) Tub family protein {ECO:0000313|EMBL:KHJ76855.1} KW=Complete proteome; Reference proteome OX=61180 OS=Oesophagostomum dentatum (Nodular worm). GN=OESDEN_23525 OC=Strongylida; Strongyloidea; Cloacinidae; Oesophagostomum.
Sequence
MFTLYDCGANPKKSNSTSDIRQELAAVIYDTNVLGFKGPRRMHILIPGIYDINTYERKSI
RPVAAKDTLLERYRQRRTDDIIVMQNKSPVWNEGADFSSYVLTVESV
Download sequence
Identical sequences A0A0B1S0V6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]