SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B1ZZ13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B1ZZ13
Domain Number 1 Region: 11-99
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 2.75e-30
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00013
Further Details:      
 
Domain Number 2 Region: 276-356
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 1.31e-29
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.0000364
Further Details:      
 
Domain Number 3 Region: 196-275
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase domain 3.53e-22
Family Methylated DNA-protein cysteine methyltransferase domain 0.00031
Further Details:      
 
Domain Number 4 Region: 93-139
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000135
Family AraC type transcriptional activator 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B1ZZ13
Sequence length 361
Comment (tr|A0A0B1ZZ13|A0A0B1ZZ13_9ACTN) 6-O-methylguanine DNA methyltransferase {ECO:0000313|EMBL:KHK94550.1} OX=1348852 OS=Mumia flava. GN=LK11_74275 OC=Bacteria; Actinobacteria; Propionibacteriales; Nocardioidaceae; Mumia.
Sequence
MQSSARPVPDTTLVEHDPRWTRVLARDPSADGQFVYAVKTTGVYCQPSSPSRLPRPENVE
FFDTPADAEAAGYRPSRRAGPDQTTVRAQQTALVAQACRRIEAADTPPTLDALAQDAGLS
PYHFHRLFKSVTGLTPKGYADAHRARKLRAQLGRGSTVTEAIYDAGFNASSRFYEASDNV
LGMTASRYRAGGVQTTIRFAVGECSLGSILVAQSDRGICAILMGDDPDALVRDLQDTFPK
AELIGGDAGFEDLVAKVVGFVEAPSIGLDLPLDVRGTAFQERVWQALREVPPGSTTSYTE
IAARIGAPQAVRAVAQACAANHIAVAIPCHRVIRRDGNTSGYRWGVERKLALLEREAQSA
A
Download sequence
Identical sequences A0A0B1ZZ13 U3GIY7
WP_009241416.1.46761 WP_009241416.1.50667 WP_009241416.1.91707 WP_009241416.1.93783 WP_009241416.1.96545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]