SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2EEZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2EEZ8
Domain Number 1 Region: 4-180
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.57e-33
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B2EEZ8
Sequence length 186
Comment (tr|A0A0B2EEZ8|A0A0B2EEZ8_HELPX) 2-oxoglutarate:acceptor oxidoreductase {ECO:0000313|EMBL:KHL83627.1} KW=Complete proteome OX=210 OS=Helicobacter pylori (Campylobacter pylori). GN=BB407_04830 OC=Helicobacteraceae; Helicobacter.
Sequence
MEAQLRFTGVGGQGVLLAGEILAEAKIVSGGYGTKTSTYTSQVRGGPTKVDILLDKDEII
FPYAKEGEIDFMLSVAQISYNQFKSDIKQGGIVVIDPNLVTPTKEDEEKYQIYKIPIISI
AKDEVGNIITQSVVALAITVELTKCVEENIVLDTMLKKVPAKVADTNKKAFEIGKKHALE
ALKVRA
Download sequence
Identical sequences A0A0B2EEZ8 B5Z6W2
gi|208434511|ref|YP_002266177.1| WP_000388030.1.35269 WP_000388030.1.6738 WP_000388030.1.99277 563041.HPG27_551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]