SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B2JFG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2JFG0
Domain Number 1 Region: 2-186
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.49e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B2JFG0
Sequence length 192
Comment (tr|A0A0B2JFG0|A0A0B2JFG0_9BACT) Indolepyruvate oxidoreductase {ECO:0000313|EMBL:KHM44981.1} KW=Complete proteome OX=1501392 OS=Coprobacter secundus. GN=PU94_13705 OC=Coprobacter.
Sequence
MKTDIILSGVGGQGILSIAAIIGEAAVKNGLYMKQAEVHGMSQRGGDVQSNLRISDTPIA
SDLIPLGKADLILSLEPMEALRYLPYLSKDGWIVTNSAPFINIPNYPETEQIMAELNKIP
NKIILDVDRIAKENGSSRTANMVLLGAATPFLNIEYDKIADGIRFIFERKGNDIVEMNLK
ALAAGRYVADNQ
Download sequence
Identical sequences A0A0B2JFG0
WP_044230737.1.69202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]