SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B2JZY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2JZY9
Domain Number 1 Region: 2-194
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-38
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B2JZY9
Sequence length 198
Comment (tr|A0A0B2JZY9|A0A0B2JZY9_9FIRM) Pyruvate ferredoxin oxidoreductase {ECO:0000313|EMBL:KHM52166.1} KW=Complete proteome; Reference proteome OX=82374 OS=Anaerovibrio lipolyticus. GN=NZ47_06400 OC=Selenomonadaceae; Anaerovibrio.
Sequence
MSKNIVLCGVGGQGTILASKLISGAAMNKGIPVKSAETIGMAQRGGSVFSHLRLGDDVDC
PMIASGSADIIIGFEPGETVRMLPYLKKGGQVIVSSRPVMPVTAALAGSNYNGSEMLDYI
RNKVEKVIVIDTEKACKELGSAKIVNLLLLGAAVNSGALGLDDEDIRKVIRTKIPEKFHE
LNFKALEYAKNAAINILI
Download sequence
Identical sequences A0A0B2JZY9 A0A1M6BUU5
WP_039207952.1.89418 WP_039207952.1.95459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]