SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2UGZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2UGZ9
Domain Number 1 Region: 43-137
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 5.62e-34
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.0000369
Further Details:      
 
Domain Number 2 Region: 139-176
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000328
Family Prokaryotic DksA/TraR C4-type zinc finger 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B2UGZ9
Sequence length 179
Comment (tr|A0A0B2UGZ9|A0A0B2UGZ9_9GAMM) RNA polymerase-binding transcription factor DksA {ECO:0000256|HAMAP-Rule:MF_00926} KW=Complete proteome OX=1148157 OS=Acinetobacter oleivorans. GN=DH17_06645 OC=Moraxellaceae; Acinetobacter.
Sequence
MANDNHNQVLDEHTEVVVEGEKASAVKRARKVKPKTSDIGTTASLFGIAPYQPKKNEEYM
SEGQLEHFRQILQAWKAELMSEVDRTLNTMQDESTALPDVNDRATQEEEFAIELRTRDRE
RKLIRKIEQSMEAIKNEDYGFCETCGIEIGLRRLEARPTATLCIDCKTLAEIKEKQNNG
Download sequence
Identical sequences A0A0B2UGZ9 A0A101KKG9
WP_042894354.1.85749 WP_042894354.1.9277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]