SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B2VK20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2VK20
Domain Number 1 Region: 4-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.28e-44
Family Calponin-homology domain, CH-domain 0.00000256
Further Details:      
 
Domain Number 2 Region: 231-292
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 9.81e-18
Family EB1 dimerisation domain-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B2VK20
Sequence length 306
Comment (tr|A0A0B2VK20|A0A0B2VK20_TOXCA) Microtubule-associated protein RP/EB family member 3 {ECO:0000313|EMBL:KHN81724.1} KW=Complete proteome; Reference proteome OX=6265 OS=Toxocara canis (Canine roundworm). GN=Tcan_07202 OC=Ascaridoidea; Toxocaridae; Toxocara.
Sequence
MSVVNVYATSATTDNMSRHEMLMWVNDCLQSNFAKIEDMHTGAAYCQFTDFLFPGSIQLR
RVKWNSNLELDWLSNWKLLQTSWKTLGVDKIVPVERLIKGKFQDNFEFLQWFKKFFDANF
DGHEYNPLDARGGEPLPSDGKTGAQSRMPARTTVSTKQPVRSTSNVSVNKDQKRTQANPI
KTTAARAPTSHTLSTGGSARSAATAASPVSMPASAHSAADLQEIANLKHELEDAKQQLTE
SDGVIVSLEKERDFYFSKLRQIEVLCQDNEQIGTVEVARILTILYETEEGFAAPDENDVE
NGEEVY
Download sequence
Identical sequences A0A0B2VK20

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]