SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B2VQP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B2VQP9
Domain Number 1 Region: 30-316
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.37e-87
Family Capz beta-1 subunit 0.00000000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B2VQP9
Sequence length 358
Comment (tr|A0A0B2VQP9|A0A0B2VQP9_TOXCA) F-actin-capping protein subunit beta isoforms 1 and 2 {ECO:0000313|EMBL:KHN83664.1} KW=Complete proteome; Reference proteome OX=6265 OS=Toxocara canis (Canine roundworm). GN=Tcan_17847 OC=Ascaridoidea; Toxocaridae; Toxocara.
Sequence
MIDTAVGAALLLFRAVAVEAPLMDLVIFESDQQLDCGLDLMRRLPPQQVEKNLNDLIDLC
PRLLDDLLSAVDQPLKIAKDKDTGKEYLLCDYNRDGDSYRSPWSNTYDPPLEDGAMPSDK
LRKLEIEVNAAFEAYRDAYFEGGVSSVYFWDLDYGFAGVVLIKKVGDGSRMIQGCWDSIH
VIEIQEKAGGRHAHYKLTSTVMLWLQTNKQGSGMMNLGGSLTRQVEADHPVNDSTNTHLV
NMGRMIEVEADHPVNDSTNTHLVNMGRMIEDMESKIRSTLNEIYFGKTKQIVTELRTTLD
AEELKRQKMIANEIKGGITKRLEVHLSLIERETGLCSGVGVEGEFFAPEWSRTSFWDY
Download sequence
Identical sequences A0A0B2VQP9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]