SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B3SAF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B3SAF5
Domain Number 1 Region: 713-912
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.013
Further Details:      
 
Domain Number 2 Region: 16-201
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000118
Family Pyruvate oxidase and decarboxylase Pyr module 0.032
Further Details:      
 
Domain Number 3 Region: 434-620
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000147
Family PFOR PP module 0.057
Further Details:      
 
Domain Number 4 Region: 266-351
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000706
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B3SAF5
Sequence length 1139
Comment (tr|A0A0B3SAF5|A0A0B3SAF5_9RHOB) MFS transporter {ECO:0000313|EMBL:KHQ53656.1} KW=Complete proteome; Reference proteome OX=561184 OS=Mameliella alba. GN=OA50_01644 OC=Rhodobacteraceae; Mameliella.
Sequence
MSKHQITLNDRFDLDKDKVLLNGTQALVRLMLTQKARDRAAGLNTAGYVTGYRGSPLGAV
DMQMRRAEKYLRAADVKFEEGLNEDLAATALWGSQQAELRGEGKFDGVFGLWYGKGPGVD
RSGDAMRHANMAGTSKHGGVLMAMGDDHTGESSTVLHQSEWALVDAYMPVVSPAGVQEIL
DYGLYGYALSRFSGLWVGLKTMKDTIEATAVVDGRPDRVQLVTPDFDMPEGGLNIRLQDT
PHAQEARMIDYKRFAAEAFSRANGMDKRVWGKPGAKIGLVAAGKNWLDLQHAMSLLGIDE
GEAERLGITTYKVGQVFPLDMQGFYDWAEGLDLIVVIEEKRKLIEVQIKEALFDNRQGRR
VYGWYKGGAGGMHRDELFPTRGALDPTWIARKLGEIFVEEGRGTDRIKAGLTQIEEAARA
DNLPEIAARLPYFCAGCPHNSSTKVPEGSRAYAGIGCHYMVQWMDRETLGFTHMGAEGAN
WIGEAPFSKRGHVFQNLGDGTYNHSGVQAIRAALAAGTNITYKILFNDAVAMTGGQKNEG
GLTPQRIAAEVKAMGVEAVAVVYDEKEEVNPASFPDGVQTFERAELEAVQKRMAQTEGVS
AIIYVQTCAAEKRRRRKRGKFPDPDQRVFINTDVCEGCGDCGVQSNCVAITPKETELGRK
REIDQSACNKDFSCLKGFCPSFVTLEGAQVKKSATTELHLPDMPAPQMPGIDGTHNVVIT
GVGGTGVVTIGAVLAQAAQIDGKGAAMMEMAGLAQKGGAVHIHLRLAETPEDISAVRVAT
GEAHALIGGDLVVSAGSKTLGLTRTGQTGAVVNSHEIITGDFTRDTEFTLPTDQLRLALE
ARLQDRVAFFDASELARATLGDSIFSNMMILGAAWQQGLIPLGHDAIAEAVELNGAAVDK
NLRAFEIGRWAVLYPQEARDLLTPKVVAKPKSLEEKIAFRADHLVEYQGKGLAKRYRKLV
DPIEDKRLKEAVAKGYHKLLAYKDEYEVARLLLETRDKAAGTFGGDFKMTFHLAPPILSK
TGADGRPVKKTFGEGMLRWFRLLARLKGLRGTPLDIFGRSEERRMERALIKQYEADMAEW
LPKARPETMDALVALAELPLQIRGFGPVKAGNEAKAAKRREELLSVLRQGGSPLKEAAE
Download sequence
Identical sequences A0A0B3SAF5
WP_043139618.1.21834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]