SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B3SIT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B3SIT6
Domain Number 1 Region: 189-373
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.24e-53
Family Methylesterase CheB, C-terminal domain 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B3SIT6
Sequence length 384
Comment (tr|A0A0B3SIT6|A0A0B3SIT6_9RHOB) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=561184 OS=Mameliella alba. GN=OA50_04947 OC=Rhodobacteraceae; Mameliella.
Sequence
MSVKSVVIATPDAAQRKRLGLVVDRMSEFEVIAQTGDLMNTYNVVEERLPKAVLIADVLA
GLAEFEVMRALFSTLDIRWLVVTVPNRRLRRPAVGGSPRSDLFSIPTDAPDEVYERQLRA
LTRTGLNPRPAAKPNPLRPTETPHSHLTRGAPTTNATRPLITTVKVQDHLTRTSRASQAD
PRTPLGRDPIILIGASTGGVDALLAVLTRFPQDCPPTLVVQHTGSGFGESLASLLDRQCL
PNVLLANGPMPLRRGQILVGAGIRAHLVLDGRAATRVTTVADGPVAGHVPSVDRLFLSAL
PVAPRVSAALLTGMGRDGADGMKALRLAGAHTLAQDEASCVVYGMPRAAVELGGVDRVLP
LKKIAEALLARRKTNVGPGREVQK
Download sequence
Identical sequences A0A0B3SIT6
WP_052244826.1.21834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]