SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B3YCF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B3YCF3
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 4.97e-37
Family H-NOX domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B3YCF3
Sequence length 178
Comment (tr|A0A0B3YCF3|A0A0B3YCF3_9ALTE) 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase {ECO:0000313|EMBL:KHT55356.1} KW=Complete proteome OX=203795 OS=Alteromonas marina. GN=RJ41_04740 OC=Alteromonadaceae; Alteromonas.
Sequence
MLGIVFTSLIDMLEEKVSPEFADDVIMEAGLENDGAYTAVGYYPFEQMQRLLGVLVEKTG
KSANELLYDFGYYLFGKLGAVHRDVLASTEGMLDMLEHLDGDIHVQVKKLYPDADLPRFT
VISRTDNTMRLQYYSERELYPLAEGLMDAAAAHYNCTLERETHQLDRPHTYEFSISLV
Download sequence
Identical sequences A0A0B3YCF3
WP_039217672.1.13129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]