SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4FDK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4FDK5
Domain Number 1 Region: 93-168
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.32e-32
Family Skp1 dimerisation domain-like 0.0000283
Further Details:      
 
Domain Number 2 Region: 10-77
Classification Level Classification E-value
Superfamily POZ domain 3.14e-22
Family BTB/POZ domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4FDK5
Sequence length 171
Comment (tr|A0A0B4FDK5|A0A0B4FDK5_METAN) SKP1 component {ECO:0000313|EMBL:KID68528.1} KW=Complete proteome OX=1276135 OS=Metarhizium anisopliae ARSEF 549. GN=MAN_03384 OC=Metarhizium.
Sequence
MSAEDTSGAKVYLVSNDNATLQVDRVVAQRSILIKHMMEDIGYDTISQDNPIPIPNVNEA
VLRKVIEWCEHHRNDPPQAQDDESDGRRRTTDIEEWDQKFMQVDQEMLFEIILAANYLDI
KPLLDVGCKTVANMIKGKSPEEIRKTFNITNDFTPEEEEQIRRENEWAEDR
Download sequence
Identical sequences A0A0A1V3I6 A0A0B4FDK5 A0A0B4GK41 A0A0D9NV19 E9F0I9
XP_007821977.1.8330 XP_014549200.1.23709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]