SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B4GE33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4GE33
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.71e-70
Family Capz alpha-1 subunit 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4GE33
Sequence length 253
Comment (tr|A0A0B4GE33|A0A0B4GE33_9HYPO) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KID78057.1} KW=Complete proteome OX=1276141 OS=Metarhizium brunneum ARSEF 3297. GN=MBR_02505 OC=Metarhizium.
Sequence
MSQVETLADVIADIKALTVSSPDIVSELTPAFEKYNEEQLVTVKLPGSSQPVVISSHNAL
GDGRYYDKASAVKTHAIEGPQVDLVTSTLKGLSAYVKEHFPNASYGAYPVESDSKVAIII
VANKYSPNNFWNGRWRSQYIFDPASGSLEGSIKVDVHYYEDGNVRLLTNKPVTASITSRT
GAGIAKEISATERKYQEELNKGFVNLSENAFKSLRRQLPVTRQKIAWDKVMSYRLGQDIG
GGNSKGSSVGSMG
Download sequence
Identical sequences A0A0B4GE33
XP_014547212.1.23709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]