SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B4GIW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4GIW8
Domain Number 1 Region: 5-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.96e-81
Family Capz beta-1 subunit 0.0000000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4GIW8
Sequence length 283
Comment (tr|A0A0B4GIW8|A0A0B4GIW8_9HYPO) WASH complex, F-actin capping protein, beta subunit {ECO:0000313|EMBL:KID87005.1} KW=Complete proteome OX=1276136 OS=Metarhizium guizhouense ARSEF 977. GN=MGU_05783 OC=Metarhizium.
Sequence
MAEIDPFDSALDLLRRLNPKHTASHLNAIISLAPDLAEDLLSSVDAPLMARRCKQSGREY
LLCDYNRDGDSYRSPWSNQFDPPLDEAGAGGVGADGNEGAGEGAIPSERVRKMEIKANDV
FDIYRDLYYEGGVSSVYLWNLDDGFAGVVLLKKSISPGRSTEGIWDSIHVFEAIERGRMT
HYKLTSTVILTLAAAGGSLGDMDLSGNMTRQVEQDMPVDGDDSHIVNVGRLVEDMELKMR
NLLQEVYFGKAKDVVGDLRSVGSLSDGARDREAQRELIGSMRR
Download sequence
Identical sequences A0A0B4GIW8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]