SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4H4Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4H4Y6
Domain Number 1 Region: 4-234
Classification Level Classification E-value
Superfamily 14-3-3 protein 8.24e-104
Family 14-3-3 protein 0.0000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4H4Y6
Sequence length 275
Comment (tr|A0A0B4H4Y6|A0A0B4H4Y6_9HYPO) 14-3-3 protein {ECO:0000313|EMBL:KID87047.1} KW=Complete proteome OX=1276136 OS=Metarhizium guizhouense ARSEF 977. GN=MGU_05825 OC=Metarhizium.
Sequence
MTTERESKTFLARLCEQAERYDEMVTYMKEVAKLGGELTVDERNLLSVAYKNVVGTRRAS
WRIISSIEQKEESKGSDKHVSTIKEYRSKIETELEKVCEDVLNVLDESLIPNAASGESKV
FYHKMKGDYHRYLAEFASGEKRKGAATAAHEAYKNATDVAQTDLTPTHPIRLGLALNFSV
FYYEILNSPDRACHLAKQAFDDAIAELDSLSEESYRDSTLIMQLLRDNLTLWTSSDNAEA
EGAGAADAPKKEEGEAADKPAEEAKAEEPAPEATN
Download sequence
Identical sequences A0A0B4H4Y6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]