SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B4HJJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4HJJ4
Domain Number 1 Region: 333-519
Classification Level Classification E-value
Superfamily MIR domain 2.49e-50
Family MIR domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B4HJJ4
Sequence length 765
Comment (tr|A0A0B4HJJ4|A0A0B4HJJ4_9HYPO) Mannosyltransferase PMTI {ECO:0000313|EMBL:KID90056.1} KW=Complete proteome OX=1276136 OS=Metarhizium guizhouense ARSEF 977. GN=MGU_02761 OC=Metarhizium.
Sequence
MARSQTPQGSLRQRNVGSKKADSSTSAVDVELDKLAKASIKKNASNCERDHWAAFSLTTI
LAFITRFWGISHPNEVVFDEVHFGKFASYYLERTYFFDVHPPFAKLLFAFMGWLVGYDGH
FHFENIGDSYIDNKVPYVAFRALPAILGALTVSVTYLIMWESGYSVPACIIAAGLVLFDN
AHIGQTRLILLDATLVLAMACSLLFYIKFYKLRHEPFSRKWWKWLILTGFALSCDMSTKY
VGTFAFVTIGAAVIIDLWDLLDIKRPGGAISLPQFGRHFAARAVGLIILPFLFYLFWFQV
HFAVLSRSGPGDDFMSPEFQETLSDNAMLANAVDIQYYDTITIKHKETKAFLHSHPDQYP
LRYDDGRVSSQGQQVTGYPHNDTNNYWQILPSSDDKQMGRKVKNNELIRLRHVGTDTILL
SHDVASPYYPTNQEFTTVSQDDAYGSRVNDTLFEIRIENGKNGQEFKTIASYFKLIHFPS
KVAMWTHTKPLPEWGSHQQEINGNKQIAPSSNIWLVDDIASLAADDARREKPERKVKTLP
FLRKWFELQRAMFYHNSKLTSSHPYASHPYQWPFLLRGVSFWTQNDTRQQIYFLGNPIGW
WLASSLLAVYIGIVLADQISLRRGIDALDHRTRSRLYNSTGFFWVAWATHYFPFFVMGRQ
LFLHHYLPAHLASCLVAGALIEFVFSAEPVDETRGPRKSPKKHLTARERLAGQSMMGAWI
ACGVVLTIVIAGWWFFLPLTYGYPGLSVEQVVRRKWLGYDLHFAK
Download sequence
Identical sequences A0A0B4HJJ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]