SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B4I2H7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4I2H7
Domain Number 1 Region: 46-74
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000112
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4I2H7
Sequence length 88
Comment (tr|A0A0B4I2H7|A0A0B4I2H7_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:KID99167.1} KW=Complete proteome; Reference proteome OX=1276143 OS=Metarhizium majus ARSEF 297. GN=MAJ_04957 OC=Metarhizium; Metarhizium majus.
Sequence
MFHPLLVLLSTAALLQVGFATPPGVRDVAAEPGNVTSNSLEDAETGRNCFCTMEYAPVCA
GNKVYASKCKAMCAGETEHLLGGCNQSS
Download sequence
Identical sequences A0A0B4I2H7
XP_014578161.1.58995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]