SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B4IBV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4IBV0
Domain Number 1 Region: 334-520
Classification Level Classification E-value
Superfamily MIR domain 7.98e-61
Family MIR domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4IBV0
Sequence length 742
Comment (tr|A0A0B4IBV0|A0A0B4IBV0_9HYPO) Dolichyl-phosphate-mannose-protein mannosyltransferase 2 {ECO:0000313|EMBL:KIE03983.1} KW=Complete proteome; Reference proteome OX=1276143 OS=Metarhizium majus ARSEF 297. GN=MAJ_00514 OC=Metarhizium; Metarhizium majus.
Sequence
MAGEKAAVASGADVGEGLRKRPVNNGTPAPVAPQPTDNKKQAAQKAEKNLVDTFVEWEHI
IAPLIFTALAFFTRLWKIGLSDIVTWDEAHFGKFGSYYIKHEYYFDVHPPLGKMLVGLSG
VLGGYNGSFEFKSGDKYPEDVNYTFMRAFNALFGIVCIPMAYYTARELNLRRPAVWLVTL
MVLCENSYTTISRFILLDSMLLCGTVATTLCWAKFHNQRHNSFEPEWFFWLFMTGFSIGC
VCSVKLVGLFVTALVGLYTIEDLWNKFGNTKMPITTLAAHVGTRVVGLIVVPFLIYLLSF
ALHFAILDRTGPGDAQMSSLFQANLKGTEVGKNSPLEIAYGSRATIKNMGYGGGLLHSHV
QTYPEGSQQQQVTCYHHKDANNDWFFYPNRREPDYDAESPDLRFIGDGTIIRLIHAQTGR
NLHSHDIAAPMSKSDKEVSSYGNLTVGDEKDHWKVEVVRDVASRDRSRIRTLTTAFRLKH
EVLGCYLKGTNKNLPQWGFKQIEVSCTKENNPRDAYTHWNVEAHWNDKLPAGDPGVYKSP
FFHDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILHVGLRMCGWDDNIVKYFLLGN
PLVYWGSTIGIGIVGLVVVWYILRWQRGFTDLNNKEIDQIHYSGIYPVAGWFLHYLPFVI
MARVTYVHHYYPALYFAILTFGFLVDWTVRNRNTVIQGATYGVLYAVIIGLYVLFMPICW
GMVGPNQKYSYMRWFDNWRISD
Download sequence
Identical sequences A0A0B4IBV0
XP_014582976.1.58995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]