SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B4K719 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4K719
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 5.49e-39
Family MIR domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1086-1216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-20
Family SPRY domain 0.027
Further Details:      
 
Domain Number 3 Region: 665-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000464
Family SPRY domain 0.057
Further Details:      
 
Domain Number 4 Region: 98-182
Classification Level Classification E-value
Superfamily MIR domain 0.000000209
Family MIR domain 0.025
Further Details:      
 
Domain Number 5 Region: 4214-4276
Classification Level Classification E-value
Superfamily EF-hand 0.000000471
Family Calmodulin-like 0.032
Further Details:      
 
Domain Number 6 Region: 2251-2349
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000392
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Weak hits

Sequence:  A0A0B4K719
Domain Number - Region: 452-630
Classification Level Classification E-value
Superfamily ARM repeat 0.00719
Family GUN4-associated domain 0.072
Further Details:      
 
Domain Number - Region: 1532-1657
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0261
Family SPRY domain 0.03
Further Details:      
 
Domain Number - Region: 2308-2349,2407-2462,2662-2794,3139-3186,3297-3321,3421-3446
Classification Level Classification E-value
Superfamily ARM repeat 0.082
Family PHAT domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B4K719
Sequence length 5134
Comment (tr|A0A0B4K719|A0A0B4K719_DROME) Ryanodine receptor, isoform I {ECO:0000313|EMBL:AFH07966.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG10844 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAEAEGGSEQDDVSFLRTEDMVTLSCTATGERVCLAAEGFGNRHCFLENIADKNVPPDLS
QCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTS
SSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NEQSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAG
QNIVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDSNELIL
VKKEEASIATTTFCLRQEKDDEKKVLEDKDLEVIGSPIIKYGDTTVIVQHCETSLWLSYK
SYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITALE
TLQSNRRHSIFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEE
GVLNLILEAIDKINIITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQF
ANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGS
SMYQKWYFEVTMDHIEQTTHMMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFD
GAFLWTGGRKTLVVDALPEEPFIRKGDVIGVAIDLSVPIITFTFNGVKVRGSFRDFNLDG
MFFPVMSCSSKLSCRFLFGGDHGRLKFAPPMGFSALVQCLMPQQILSLDPCFYFGNLAKN
VLAGPWLIEDDTAFVPKPVDTTGVTLPSSVDQIKEKLAENIHEMWALNKIEAGWSWGEHR
DDYHRIHPCLTHFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIRPVRLPNEI
FMQGNGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRS
PHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEAQRLKFAGFRT
YRVERNYAVTSGKWYFEFEVLTSGPMRVGWARADCYPGAMLGSEDTSWAFDGHNEEKVYG
GVSESFGKQCGPGDIVGVFLDLADHTISFSLNGELLMDALGGETTFADVTAEGVGFVPAC
TLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMP
DCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMGEFISEQEKARRWD
EIKNRQYRLMREAEIAAQMQVQTQAAHMDHMLKGGFNMNDIKGLTRNFDEHADAEADHMM
RGPNRPPRKGSLTRNITFETDMSAALDEMQRSTSVLDMNGLGEEMDDKKKRGRSPFKFFS
KKSRDQSREKMGARTLDTSLERRNTVAHGRNVVNQQMTTRAPTLRLNNAEIPPSPVPQGP
KQLSGSNLGQQPVETSGDEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLHS
REFNKNKVRRGSVYIEDDYEMAIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFVGC
FVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAA
VLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTALQVHALKLSDVRGWSMLCEDPVSMLA
LHIPEEDRCIDILELIEMDKLLSFHAHSLTLYAALCYQSNYRAAHALCQHVDQKQLLYAI
RSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGAELKELYSDEEMQHSLRSL
VTESVRPQLRMTEITPPVIATSSMPSVSSEPIPDIDQLYSPKFPLEVVRQFVMEALKDAV
EINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQRLLVMIDPETWDQAFEREG
KDEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYI
EIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFKNLEPDDQDNCTCGLELRGRLGDFHDS
LMQKVSLNALQEPDGVEGTAIEEVKTGPITKIYNFINTVKELEEGPKEVEEPEKKTPEEV
FRKVLIKTIVSWAEESQIENPKLVREMFSLLLRQYDTVGELVRALEKTYVINTRARDDVA
EMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMN
TLGRRAQAQSDAPTQSEVAEGAPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFD
FLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSE
LVEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEG
EGLFRAIVEANRMSERISDRCKMQDEAEGTIAGLNFTHPLPEGEEDEDYIDTGAAILNFY
CTLVDLLGRCAPDASVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLSQTAPGEEKP
KSDMPSGLLPNNKQSIVLFLERVYGIEAQDLFYRLLEDAFLPDLRTATILDKSDGSESDM
ALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDF
LVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGA
SSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNTDEDYYG
RQMGAPDQPQYMPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGDIRSDN
DRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEVEVALNHRGSTRRQSKP
QINEFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELNGCGGVI
HPQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKPSKGGAVEEGGATQAAVELRFS
YSLLEKLIQYLDRATINMKLLKPSTTFSRRSSFKTATRDIKFFSKVVLPLMEKYFSTHRN
YFIAIATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGID
ARTLTKNCPEFIRTSMLTFFNQTSDDLGNTILNLQDGKYSHLRGTHLKTSTSLGYVNQVV
LPVLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDGTLTHDRKYLKTEIERHR
PALGSCLGAYSSCFPVAFLEPHLNKHNQYSLLNRIADHSLEAQDIMVKMESCMPNLETIL
AEVDQFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNHVTMVTADHMNP
LLRNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLH
KEDSMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEA
EELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPTATRRSAISEGAPAVGGKV
KKKKKNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYLKKMPEYD
VIEFARNQLTLPDKLDPSDEMSWQHYLYSKLGKTEEPVDEQALEKANVNSNEKGKDKTQE
TVDRIVAMAKVLFGLHMAASSKNRSKRWGSKISVARRQAVISSLRAKHLYRMSRHRACNI
FARSYYEQWLQEENVGQEVMVEDLTQTFEDSEKSKKEGEETDSKPDPLTQLVTTFCRGAM
TERSGALQEDLLYMSYAQIAAKSTGKEEEEGGDEEGGEGGEEGEGTSIHEQEMEKQKLLF
HQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEKKD
VGFFTSIAGLMNSCSVLDLDAFERNTKAEEYIPSAGAGLGVGSEGAAGEKNMHDAEFTCA
LFRFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEII
DPAGKANFFKAIEVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKL
SKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESASNVELILKYFD
MFLKLADLIESPSFHEVDMKNEGWVTPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKI
DYRAFVEHFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEI
LGSSKRIERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIF
EMTHASGLMATDDGGGNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLS
PANIKHQIGVMQTKSIPELIVGFFKIIFYIFYYTGYAHFCVVRYIFGILLNLMRGPAPEQ
EEEPVVEEETFGRALPPLPLEEPPGTVQAFGLDINKEENGMYKVVVHESPANSSMEEGGE
SSPEDGAAASGELVEGEPHQEPISIVDLLGGEAAKKAAQERQEAQKAQEAAMASIEAEAK
KSSSAPQETPAVHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSFTE
EADSSAEEELILGSGSGGGADITGSGFGGSGDGGSGDGEMEDEIPELVHVDEDFFYMEHV
LRIAACLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFEGLFIAEQPEDDDFKSHWD
KLVISAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSTFAAQESEETGIFKYI
MNIDWRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQ
SVTHNGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYK
GVRAGGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQLES
VKDNMESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETY
VWNMYQQRSWDFFPVGDCFRKQYEDELSGGGGGG
Download sequence
Identical sequences A0A0B4K719
FBpp0300426 FBpp0293114 NP_001246211.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]