SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B4LGN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B4LGN1
Domain Number 1 Region: 242-454
Classification Level Classification E-value
Superfamily MIR domain 1.39e-58
Family MIR domain 0.000000228
Further Details:      
 
Domain Number 2 Region: 455-625
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.88e-53
Family IP3 receptor type 1 binding core, domain 2 0.00000067
Further Details:      
 
Domain Number 3 Region: 1220-1372
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 6.8e-38
Family IP3 receptor type 1 binding core, domain 2 0.0049
Further Details:      
 
Domain Number 4 Region: 112-218
Classification Level Classification E-value
Superfamily MIR domain 0.000000000000889
Family MIR domain 0.019
Further Details:      
 
Weak hits

Sequence:  A0A0B4LGN1
Domain Number - Region: 1379-1397,1513-1728,2032-2220
Classification Level Classification E-value
Superfamily ARM repeat 0.00117
Family Armadillo repeat 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B4LGN1
Sequence length 2828
Comment (tr|A0A0B4LGN1|A0A0B4LGN1_DROME) Inositol 1,4,5,-tris-phosphate receptor, isoform C {ECO:0000313|EMBL:AHN57179.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG1063 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGDNIIGSASFLHLGDIVSLYAEGSVCGFLSTLGLVDDRTVVCPEAGDLSCPPKKFRDCL
IKICPMNRYSAQKQFWKAAKQSASSNTDPNLLKRLHHAAEIEKKQNETENKKLLGTSIQY
GRAVVQLLHLKSNKYLTVNKRLPSLLEKNAMRVYLDANGNEGSWFYIKPFYKLRSIGDYV
VVGDKVILSPVNADQQNLHVAANYELPDNPGCKEVNVLNSSTSWKISLFMEHKENQEHIL
KGGDVVRLFHAEQEKFLTMDEYKKQYHVFLRTTGRTSATAATSSKALWEIEVVQHDSCRG
GAGDWNSLYRFKHLATGHYLAAEAEIDVSAGAMSATSASGHDLHLGDCSKDSGLSCSTMN
STINDKPKGKQYRLVSVPYSADIASVFVLDATTMARPDSLVPQSSYVRLQHICSNTWVHA
TSIPIDADDDKPVMSMVCCSPIKEDKEAFALIPVSPVEVRDLDFANDACKVLATVTSKLD
NGSISINERRALISLLQDIVYFIAGMENEQNKTKALEFTIKNPIRDRQKLLREQYILKQL
FKILQGPFQQHTAGDGPFLRLDELSDPKNSPYKNIFRLCYRILRLSQQDYRKNQEYIAKH
FGLMQKQIGYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMHNWDSRFLDYL
SDLCVSNRKAIAVTQELICKSVLSDKNKDILIETQVKALRTGSGPVRCYKGNSEDVCLAT
LAEDAGDDEDRSDVQSTSTTTTWDSASLNEDDGTPSTGDKYEIHLKWTGQPTSRSMADLA
SCDGGELEAAILNYYRHQLNLFSNMCLNRQYLALNELSPRLDIDLILKCMSDETMPYELR
ASFCRLMLHLHVDRDPQEPVTPVKYARLWSEIPSKMSIQDYDGKNQQPDQNKQACRAKFN
TTIAFVENYLCNVATKVWLFTDQEQNKLTFEVVKLARDLIYFGFYSFSDLLRLTKTLLSI
LDCVSDTSSGEFASTDIDSEGGVLRSIGDINTVMTSLALGSVGQAIAAPTISLQQRKSVS
QLMKEYPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFKREFDESEVAASAASNEASQQ
QSQQQEPQTPGSSNETDPLDSAESVAAGAAAAAATTARQKNIDLESIGVQAEGIFDCERS
DAANLDLDGQGGRTFLRVLLHLIMHDYAPLVSGALHLLFRHFSQRQEVLQAFRQVQLLVS
DSDVESYKQIKSDLDILRQSVEKSELWVYKAKATDELGATDAGGDAVSLEYNAALSQEQR
NEYRKVKEILIRMNKFCVTASGPGSVVKPRKHEQRLLRNVGVHTVVLDLLQNPYDEKDDE
LMKELMCLAHEFLQNFCLGNQQNQVLLHNHLDLFLNPGILEAKTVCAIFKDNLALCNEVT
DKVVQHFVHCIEIHGRHVAYLQFLQTVVRAENQFIRRCQDMVMQELINSGEDVLVFYNDK
GSFNHFVQMMQQQMLRMEKLSDDSPLKYHVELVKLLACCTMGKNVYTEIKCNNLLSLDDI
VTIICHPLCMPEVKEAYVDFLNHCYIDTEVEMKEIYASGHMWSLFEKSFLVDINQLITNP
AAASNKTLQAYVLNGVTNLLGSFFASPFSDQSAIVQSRQLIFVQLLQAAHRITQCRWLSL
GDRFNVENCIRTLTESAKMRSIALPPELEQQVATMSSKTAMLTRQTTKWLLASKQPKYEA
QQAASLMRWDRSIIEGLQDIVSLLEDQLKPVVEAELSLLVDILYRSELLFPAGTEARKRC
ESGGFIRKLIKHTEKLLEEKEERMCVKVLRTLREMMAIDVNYGEKGDALRQTLLLRYFQT
KSTPRLPEDEVPLLAAPLMDPAKQNHLVTHGPGAKYLQRAGKTLHEMQNHLDREGASDLV
VELVIKSVHSPNIFVEAVELGIALLEGGNPIIQKGMFQKFLSDDLNQAFFKVFFEKMKDA
QQEIKSTVTVNTTDIAAKAHEHKQDTNLELDKIARKHGLKSNGVVITEELKRELHNAGLA
TARAYGNARNIHSGEESSAISVNSPLEDILAEKLEKHKDSRDQRNQLSNKVLVMQPILRF
LQLLCENHNPDMQNLLRNQNNKTNNNLVSETLMFLDCICGSTTGGLGLLGLYINEHNVAL
INQTLEALTEYCQGPCHENQNCIATHESNGLDIITALILNNINPLGENRMDLVLELKNNA
SKLLLAIMESRGDSENAERILYNMNPKQLVEVACKAYHQEELIDEQDDGDEPDAGSDDDD
ATVSPREVGHNIYILCHQLAQHNKELAGLLKASEDPQSASFDAKTSQALMYYATHTAQIE
IVRNDRTLEQIVFPIPEICEYLTTDTKIKILNTAERDDQGSKVADFFDKAEEMFNEMKWQ
KKLRSQPLLFWISSYMSLWSNILFNCVVVINMIVAFFYPFDNTVPELSSHISLLFWIITI
FSLVIVLALPRESGIRTFIGSVILRFIFLLGPESTLCLLGVVTVTLKSVHIVSIMGNKGT
LEKQLIKIITDFQLLYHCIYIAFCFCGLIFHPFFYSLLLFDVVYREETLVNVIRSVTRNG
RSIVLTAVLALILVYLFSIIGYMFFKDDFLVSVDFEEQDNAPPPSVPLTLSVPVSGDSCS
APDDLGNCQAAKEVAPPSAGGGEVKERSCDSLVMCIVTTLNQGLRNGGGIGDILRAPSSK
EGLFVARVIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKEAILKTTCFICSLNRS
AFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKAGILEWFPRLR
AMSLAAVDADGEQIELRSMQAQLLDTQLLIKNLSTQLHELKDHMTEQRKQKQRLGLLNTT
ANSLLPFQ
Download sequence
Identical sequences A0A0B4LGN1
NP_001287180.1.81976 NP_730942.1.81976 FBpp0078335 FBpp0078335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]