SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5CSW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5CSW0
Domain Number 1 Region: 28-179
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 9.68e-55
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00026
Further Details:      
 
Domain Number 2 Region: 182-262
Classification Level Classification E-value
Superfamily PreATP-grasp domain 8.63e-31
Family BC N-terminal domain-like 0.00012
Further Details:      
 
Domain Number 3 Region: 2-33
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.000000742
Family BC ATP-binding domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5CSW0
Sequence length 262
Comment (tr|A0A0B5CSW0|A0A0B5CSW0_9CARA) CAD {ECO:0000313|EMBL:AJE25936.1} OX=1598086 OS=Bembidion cooperi. GN= OC=Carabidae; Trechinae; Bembidiini; Bembidion; Liocosmius.
Sequence
RVSTKIGSSMKSVGEVMAIGRKFEEAFQKALRMVDENVNGFDPYLRKVDDEELKEPTDKR
MFVVAAALKEGYTVDKLYELTKIDRWFLQKMKHIIDYQNLLEQKDQHSLTYTDLLKAKQI
GFSDKQIAASVKSTELAIRKQREECGVLPFVKQIDTVAAEWPATTNYLYITYNASSHDLE
FKEEHTMVLGSGVYRIGSSVEFDWCAVGCLRELRKLGRKTIMVNYNPETVSTDYDMSDRL
YFEEISFEVVMDIYNLENPAGI
Download sequence
Identical sequences A0A0B5CSW0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]