SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5FGW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5FGW5
Domain Number 1 Region: 6-118
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 3.57e-17
Family HEPN domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5FGW5
Sequence length 122
Comment (tr|A0A0B5FGW5|A0A0B5FGW5_9DELT) Uncharacterized protein {ECO:0000313|EMBL:AJF06583.1} KW=Complete proteome; Reference proteome OX=483547 OS=Geoalkalibacter subterraneus. GN=GSUB_08495 OC=Geobacteraceae; Geoalkalibacter.
Sequence
MKKLTEEWLRAAKDDLDVMEKILGEAHLSHITAFHAQQCIEKAFKAVYEEHGIESRKIHN
LITLYGGIEEVLSQEMDLALLKTLDSLYIEARYPGELGLLPSGRPSLADAEKFYDYAKFW
QS
Download sequence
Identical sequences A0A0B5FGW5
WP_040200267.1.72676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]