SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5HBD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5HBD2
Domain Number 1 Region: 37-204,267-286
Classification Level Classification E-value
Superfamily Cytochrome f, large domain 1.44e-95
Family Cytochrome f, large domain 0.0000000196
Further Details:      
 
Domain Number 2 Region: 204-266
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 4.71e-21
Family Cytochrome f, small domain 0.00011
Further Details:      
 
Domain Number 3 Region: 283-321
Classification Level Classification E-value
Superfamily Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 8.11e-16
Family Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5HBD2
Sequence length 321
Comment (tr|A0A0B5HBD2|A0A0B5HBD2_9SPER) Cytochrome f {ECO:0000256|HAMAP-Rule:MF_00610} OX=60867 OS=Araucaria scopulorum. GN=petA OC=Spermatophyta; Pinidae; Araucariales; Araucariaceae; Araucaria.
Sequence
MQNRNTYDDWVKKWITQPISVLIMIHIITRASIANAYPIFAQQSYENPREATGRIVCANC
HLAKKPVEIEVPQSVLPDTVFEAVVKIPYDTQIKQVLANGKKGTLNVGAVLILPEGFELA
PPDRISPEIKEKIGNLYFQNYRPNQKNIIVIGPVPGQKYSEVVFPILSPNPASNKEAHFL
KYPIYVGGNRGRGQIYPDGSKSNNTVYNASATGRVSKILRKGKGGYEITIDNSSDGRQVV
DIVPPGPELLVSEGEFIKVDQPLTNNPNVGGFGQGDAEIVLQDPSRVEGLLLFLASVILA
QIFLVLKKKQFEKVQLAEMNF
Download sequence
Identical sequences A0A0B5H1N6 A0A0B5H5J7 A0A0B5H8J6 A0A0B5H983 A0A0B5HAH3 A0A0B5HBD2 A0A0B5HD77 A0A0B5HDP8 A0A0B5HFW9 A0A0B5HIW6 A0A0B5HJJ9 A0A0B5HM10 A0A0C4SCW1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]