SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B5JS31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5JS31
Domain Number 1 Region: 29-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 4.85e-16
Family Ovomucoid domain III-like 0.013
Further Details:      
 
Domain Number 2 Region: 141-221
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000235
Family Calbindin D9K 0.045
Further Details:      
 
Domain Number 3 Region: 227-268
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000324
Family VWC domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B5JS31
Sequence length 314
Comment (tr|A0A0B5JS31|A0A0B5JS31_DANRE) Fstl1a {ECO:0000313|EMBL:AJG05926.1} OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=fstl1a OC=Cyprinidae; Danio.
Sequence
MVIRTRFLFIALSFVCCYAEGVRSKSKVCANVFCGAGRECSVTEKGEPTCLCIEQCKPHN
RPVCGSNGKMYQNHCELHRDACLTGVKIQISHDGLCEEKKMEKIINSPIVCYLADRNELR
SRVIEWLQSEVEPDGWFSKGSNFSDVLLKYFQSYDNGDAQLDSAELLKFIQHNETAVNIT
SPYAEDENNRLLRSLCVDALIELSDENADWKLSFDEFLNCLRPGFNPPERKCALEDETYE
DGAETQMECNRCICACGNWVCTAVICDGSNKLQALEEMEGNNQEMTEEEWVQRVAELNKH
QETVEKMKMGDKEV
Download sequence
Identical sequences A0A0B5JS31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]