SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B5QHD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B5QHD3
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily Homeodomain-like 4.85e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0068
Further Details:      
 
Weak hits

Sequence:  A0A0B5QHD3
Domain Number - Region: 44-123
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0654
Family Capz alpha-1 subunit 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B5QHD3
Sequence length 202
Comment (tr|A0A0B5QHD3|A0A0B5QHD3_CLOBE) TetR family transcriptional regulator {ECO:0000313|EMBL:AJH01755.1} KW=Complete proteome OX=1520 OS=Clostridium beijerinckii (Clostridium MP). GN=CLBEI_46180 OC=Clostridium.
Sequence
MNTREKIISESLNLFSRKGFDAISVRDIAKAVGIKASSLYNHFKNKQDIFDTIIQKYSDL
VNKFLNSIKIRDNSDENLPNKTNWLSDEYFFKKSSYIFNFYLEDENMIKFRKLLTIEQCN
NSKLSDLYNKIFIDDILDFQADVFSKLISSNVFIKKDPYTLALQFYSPVFLLFYKHENLT
DKERRFLENHISEFKDTYIVKG
Download sequence
Identical sequences A0A0B5QHD3 A0A0K2M8D7 A0A202CUI3
WP_017212122.1.15846 WP_017212122.1.16915 WP_017212122.1.1793 WP_017212122.1.2274 WP_017212122.1.27559 WP_017212122.1.33930 WP_017212122.1.41106 WP_017212122.1.48361 WP_017212122.1.65774 WP_017212122.1.95078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]