SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B6U299 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6U299
Domain Number 1 Region: 2-183
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.93e-46
Family Methylesterase CheB, C-terminal domain 0.0000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B6U299
Sequence length 184
Comment (tr|A0A0B6U299|A0A0B6U299_CAMJU) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=32022 OS=Campylobacter jejuni subsp. jejuni. GN=A6J92_005630 OC=Campylobacteraceae; Campylobacter.
Sequence
MKLILIGSSTGGPNQLKFLLKDIDVKNTCVVIAQHMSASFIPSFVGQFNKEAFSEVCLLN
DKEILSNKIYICPKNTILSGNLNIVAAWQDVASSFKPSVDLLFHSAVSLAKTNKILAIIL
TGMGDDGAKGLFELYKTGVRCLCENEADSVVYGMPKRAKDMNPHLKPMSLKEIKKEIVNF
IDQD
Download sequence
Identical sequences A0A059I3S3 A0A0B6U299 A0A0E1ZJN6 A0A1E7PNW3 A0A2K1WM16 A5KH75 Q0P9X5
gi|543949888|ref|YP_008542232.1| gi|384448176|ref|YP_005656227.1| gi|543946330|ref|YP_008538834.1| gi|403055666|ref|YP_006633071.1| gi|543948108|ref|YP_008540509.1| gi|57237752|ref|YP_179000.1| 192222.Cj0924c 195099.CJE1002 gi|218562543|ref|YP_002344322.1| gi|384443276|ref|YP_005659528.1| gi|407942320|ref|YP_006857962.1| gi|544062551|ref|YP_008562256.1| WP_002853263.1.100068 WP_002853263.1.100358 WP_002853263.1.100416 WP_002853263.1.100636 WP_002853263.1.100792 WP_002853263.1.100842 WP_002853263.1.100958 WP_002853263.1.100968 WP_002853263.1.101242 WP_002853263.1.101273 WP_002853263.1.101513 WP_002853263.1.101664 WP_002853263.1.101723 WP_002853263.1.101807 WP_002853263.1.101886 WP_002853263.1.10254 WP_002853263.1.10356 WP_002853263.1.10462 WP_002853263.1.10601 WP_002853263.1.10699 WP_002853263.1.10881 WP_002853263.1.11022 WP_002853263.1.11065 WP_002853263.1.11288 WP_002853263.1.1129 WP_002853263.1.11331 WP_002853263.1.11336 WP_002853263.1.11684 WP_002853263.1.1235 WP_002853263.1.12799 WP_002853263.1.13240 WP_002853263.1.13264 WP_002853263.1.13372 WP_002853263.1.13404 WP_002853263.1.13519 WP_002853263.1.13562 WP_002853263.1.13689 WP_002853263.1.1376 WP_002853263.1.13832 WP_002853263.1.13900 WP_002853263.1.14014 WP_002853263.1.14405 WP_002853263.1.14571 WP_002853263.1.14742 WP_002853263.1.14781 WP_002853263.1.14891 WP_002853263.1.154 WP_002853263.1.15561 WP_002853263.1.16187 WP_002853263.1.1679 WP_002853263.1.16796 WP_002853263.1.16820 WP_002853263.1.16926 WP_002853263.1.17095 WP_002853263.1.17171 WP_002853263.1.17462 WP_002853263.1.17486 WP_002853263.1.17852 WP_002853263.1.17970 WP_002853263.1.18051 WP_002853263.1.18219 WP_002853263.1.18221 WP_002853263.1.18252 WP_002853263.1.18253 WP_002853263.1.1828 WP_002853263.1.1875 WP_002853263.1.18954 WP_002853263.1.19041 WP_002853263.1.19078 WP_002853263.1.19191 WP_002853263.1.19202 WP_002853263.1.19381 WP_002853263.1.19580 WP_002853263.1.19695 WP_002853263.1.19714 WP_002853263.1.19870 WP_002853263.1.20077 WP_002853263.1.20237 WP_002853263.1.20285 WP_002853263.1.20292 WP_002853263.1.20645 WP_002853263.1.208 WP_002853263.1.20956 WP_002853263.1.21363 WP_002853263.1.21475 WP_002853263.1.21512 WP_002853263.1.21754 WP_002853263.1.21770 WP_002853263.1.21805 WP_002853263.1.21857 WP_002853263.1.21897 WP_002853263.1.21928 WP_002853263.1.22321 WP_002853263.1.22817 WP_002853263.1.23143 WP_002853263.1.23465 WP_002853263.1.23610 WP_002853263.1.24037 WP_002853263.1.2411 WP_002853263.1.24438 WP_002853263.1.24539 WP_002853263.1.24558 WP_002853263.1.24671 WP_002853263.1.24675 WP_002853263.1.24698 WP_002853263.1.24720 WP_002853263.1.24785 WP_002853263.1.24806 WP_002853263.1.24986 WP_002853263.1.25211 WP_002853263.1.25369 WP_002853263.1.25373 WP_002853263.1.25665 WP_002853263.1.25943 WP_002853263.1.26 WP_002853263.1.26214 WP_002853263.1.26221 WP_002853263.1.26248 WP_002853263.1.26458 WP_002853263.1.26739 WP_002853263.1.26811 WP_002853263.1.27041 WP_002853263.1.27100 WP_002853263.1.27276 WP_002853263.1.27433 WP_002853263.1.27444 WP_002853263.1.2770 WP_002853263.1.27906 WP_002853263.1.2792 WP_002853263.1.2807 WP_002853263.1.28240 WP_002853263.1.28285 WP_002853263.1.2843 WP_002853263.1.28518 WP_002853263.1.29637 WP_002853263.1.29773 WP_002853263.1.29808 WP_002853263.1.29837 WP_002853263.1.30116 WP_002853263.1.30441 WP_002853263.1.30484 WP_002853263.1.3062 WP_002853263.1.30663 WP_002853263.1.31398 WP_002853263.1.31560 WP_002853263.1.31607 WP_002853263.1.31676 WP_002853263.1.31747 WP_002853263.1.31864 WP_002853263.1.32302 WP_002853263.1.32427 WP_002853263.1.32452 WP_002853263.1.32513 WP_002853263.1.32759 WP_002853263.1.33162 WP_002853263.1.33249 WP_002853263.1.3366 WP_002853263.1.33739 WP_002853263.1.33997 WP_002853263.1.34283 WP_002853263.1.34433 WP_002853263.1.34488 WP_002853263.1.34552 WP_002853263.1.34823 WP_002853263.1.3501 WP_002853263.1.35079 WP_002853263.1.35226 WP_002853263.1.35241 WP_002853263.1.35293 WP_002853263.1.35324 WP_002853263.1.35952 WP_002853263.1.35997 WP_002853263.1.36407 WP_002853263.1.37082 WP_002853263.1.37418 WP_002853263.1.37639 WP_002853263.1.37646 WP_002853263.1.37823 WP_002853263.1.38315 WP_002853263.1.38495 WP_002853263.1.38714 WP_002853263.1.3900 WP_002853263.1.39194 WP_002853263.1.39429 WP_002853263.1.39640 WP_002853263.1.39743 WP_002853263.1.39750 WP_002853263.1.39810 WP_002853263.1.39893 WP_002853263.1.40807 WP_002853263.1.40919 WP_002853263.1.41150 WP_002853263.1.41164 WP_002853263.1.41175 WP_002853263.1.41380 WP_002853263.1.41421 WP_002853263.1.41676 WP_002853263.1.41745 WP_002853263.1.41766 WP_002853263.1.41840 WP_002853263.1.42543 WP_002853263.1.42609 WP_002853263.1.43183 WP_002853263.1.43217 WP_002853263.1.43574 WP_002853263.1.43628 WP_002853263.1.43760 WP_002853263.1.44039 WP_002853263.1.4421 WP_002853263.1.44221 WP_002853263.1.44249 WP_002853263.1.44298 WP_002853263.1.44383 WP_002853263.1.45151 WP_002853263.1.45391 WP_002853263.1.45438 WP_002853263.1.46004 WP_002853263.1.46176 WP_002853263.1.4658 WP_002853263.1.46763 WP_002853263.1.468 WP_002853263.1.46943 WP_002853263.1.47196 WP_002853263.1.47446 WP_002853263.1.48021 WP_002853263.1.48271 WP_002853263.1.48314 WP_002853263.1.485 WP_002853263.1.48597 WP_002853263.1.48803 WP_002853263.1.49316 WP_002853263.1.50170 WP_002853263.1.50213 WP_002853263.1.50297 WP_002853263.1.50385 WP_002853263.1.50392 WP_002853263.1.50400 WP_002853263.1.50614 WP_002853263.1.50763 WP_002853263.1.50812 WP_002853263.1.5097 WP_002853263.1.51026 WP_002853263.1.5103 WP_002853263.1.51415 WP_002853263.1.51618 WP_002853263.1.52387 WP_002853263.1.52702 WP_002853263.1.52711 WP_002853263.1.52727 WP_002853263.1.52732 WP_002853263.1.53003 WP_002853263.1.53289 WP_002853263.1.53793 WP_002853263.1.53913 WP_002853263.1.53979 WP_002853263.1.54060 WP_002853263.1.54092 WP_002853263.1.54441 WP_002853263.1.54452 WP_002853263.1.54592 WP_002853263.1.5497 WP_002853263.1.55153 WP_002853263.1.55240 WP_002853263.1.55476 WP_002853263.1.55481 WP_002853263.1.55661 WP_002853263.1.55875 WP_002853263.1.56094 WP_002853263.1.56230 WP_002853263.1.56279 WP_002853263.1.56351 WP_002853263.1.56397 WP_002853263.1.56688 WP_002853263.1.56922 WP_002853263.1.56983 WP_002853263.1.57091 WP_002853263.1.57361 WP_002853263.1.5737 WP_002853263.1.57437 WP_002853263.1.57498 WP_002853263.1.57733 WP_002853263.1.57741 WP_002853263.1.57958 WP_002853263.1.58002 WP_002853263.1.58149 WP_002853263.1.5843 WP_002853263.1.58505 WP_002853263.1.58546 WP_002853263.1.58576 WP_002853263.1.5866 WP_002853263.1.5888 WP_002853263.1.59093 WP_002853263.1.59195 WP_002853263.1.59362 WP_002853263.1.59383 WP_002853263.1.59516 WP_002853263.1.59550 WP_002853263.1.59555 WP_002853263.1.59795 WP_002853263.1.60034 WP_002853263.1.60240 WP_002853263.1.60399 WP_002853263.1.60531 WP_002853263.1.60548 WP_002853263.1.61064 WP_002853263.1.61246 WP_002853263.1.61249 WP_002853263.1.61283 WP_002853263.1.61383 WP_002853263.1.61465 WP_002853263.1.61761 WP_002853263.1.6187 WP_002853263.1.62153 WP_002853263.1.62305 WP_002853263.1.62423 WP_002853263.1.62439 WP_002853263.1.62451 WP_002853263.1.62457 WP_002853263.1.6254 WP_002853263.1.62545 WP_002853263.1.62568 WP_002853263.1.62623 WP_002853263.1.62672 WP_002853263.1.62865 WP_002853263.1.63100 WP_002853263.1.63528 WP_002853263.1.63837 WP_002853263.1.63885 WP_002853263.1.6402 WP_002853263.1.64025 WP_002853263.1.64592 WP_002853263.1.64790 WP_002853263.1.64878 WP_002853263.1.65060 WP_002853263.1.65073 WP_002853263.1.65129 WP_002853263.1.6545 WP_002853263.1.65500 WP_002853263.1.65644 WP_002853263.1.65735 WP_002853263.1.65824 WP_002853263.1.65833 WP_002853263.1.65927 WP_002853263.1.66067 WP_002853263.1.66467 WP_002853263.1.66802 WP_002853263.1.67015 WP_002853263.1.67069 WP_002853263.1.67138 WP_002853263.1.67216 WP_002853263.1.67511 WP_002853263.1.67675 WP_002853263.1.67818 WP_002853263.1.67847 WP_002853263.1.68389 WP_002853263.1.68463 WP_002853263.1.6862 WP_002853263.1.68625 WP_002853263.1.68826 WP_002853263.1.69031 WP_002853263.1.69044 WP_002853263.1.69312 WP_002853263.1.69516 WP_002853263.1.69580 WP_002853263.1.69737 WP_002853263.1.6976 WP_002853263.1.69860 WP_002853263.1.70749 WP_002853263.1.70788 WP_002853263.1.71045 WP_002853263.1.71370 WP_002853263.1.71465 WP_002853263.1.71472 WP_002853263.1.71478 WP_002853263.1.7176 WP_002853263.1.71776 WP_002853263.1.71884 WP_002853263.1.7207 WP_002853263.1.72159 WP_002853263.1.72239 WP_002853263.1.72313 WP_002853263.1.72519 WP_002853263.1.72607 WP_002853263.1.72627 WP_002853263.1.72709 WP_002853263.1.72863 WP_002853263.1.72925 WP_002853263.1.72941 WP_002853263.1.73090 WP_002853263.1.73097 WP_002853263.1.73138 WP_002853263.1.73321 WP_002853263.1.73406 WP_002853263.1.73534 WP_002853263.1.73649 WP_002853263.1.73767 WP_002853263.1.74125 WP_002853263.1.74140 WP_002853263.1.74315 WP_002853263.1.74360 WP_002853263.1.74472 WP_002853263.1.74803 WP_002853263.1.7481 WP_002853263.1.74864 WP_002853263.1.75460 WP_002853263.1.75503 WP_002853263.1.75611 WP_002853263.1.75820 WP_002853263.1.76011 WP_002853263.1.76449 WP_002853263.1.76546 WP_002853263.1.76559 WP_002853263.1.76586 WP_002853263.1.76658 WP_002853263.1.76847 WP_002853263.1.76904 WP_002853263.1.77068 WP_002853263.1.77207 WP_002853263.1.77380 WP_002853263.1.77573 WP_002853263.1.77662 WP_002853263.1.77828 WP_002853263.1.77921 WP_002853263.1.78159 WP_002853263.1.78310 WP_002853263.1.78406 WP_002853263.1.78508 WP_002853263.1.78576 WP_002853263.1.78614 WP_002853263.1.78684 WP_002853263.1.78999 WP_002853263.1.79025 WP_002853263.1.79113 WP_002853263.1.79231 WP_002853263.1.79430 WP_002853263.1.79449 WP_002853263.1.79535 WP_002853263.1.79613 WP_002853263.1.79770 WP_002853263.1.79833 WP_002853263.1.79874 WP_002853263.1.79937 WP_002853263.1.80139 WP_002853263.1.80202 WP_002853263.1.80259 WP_002853263.1.80553 WP_002853263.1.80633 WP_002853263.1.80652 WP_002853263.1.80751 WP_002853263.1.80807 WP_002853263.1.80825 WP_002853263.1.8122 WP_002853263.1.81447 WP_002853263.1.81578 WP_002853263.1.81664 WP_002853263.1.81737 WP_002853263.1.8175 WP_002853263.1.82083 WP_002853263.1.82126 WP_002853263.1.82311 WP_002853263.1.82383 WP_002853263.1.82640 WP_002853263.1.83436 WP_002853263.1.83819 WP_002853263.1.83895 WP_002853263.1.84246 WP_002853263.1.84261 WP_002853263.1.84803 WP_002853263.1.84835 WP_002853263.1.85240 WP_002853263.1.85309 WP_002853263.1.85419 WP_002853263.1.85714 WP_002853263.1.85725 WP_002853263.1.86555 WP_002853263.1.86579 WP_002853263.1.87184 WP_002853263.1.87295 WP_002853263.1.87304 WP_002853263.1.87487 WP_002853263.1.87527 WP_002853263.1.87669 WP_002853263.1.87957 WP_002853263.1.88134 WP_002853263.1.88272 WP_002853263.1.88403 WP_002853263.1.8846 WP_002853263.1.88515 WP_002853263.1.88643 WP_002853263.1.88784 WP_002853263.1.88833 WP_002853263.1.88835 WP_002853263.1.88889 WP_002853263.1.88927 WP_002853263.1.89384 WP_002853263.1.89485 WP_002853263.1.89661 WP_002853263.1.8994 WP_002853263.1.90075 WP_002853263.1.90216 WP_002853263.1.90277 WP_002853263.1.9044 WP_002853263.1.91047 WP_002853263.1.91326 WP_002853263.1.91330 WP_002853263.1.91537 WP_002853263.1.91661 WP_002853263.1.91753 WP_002853263.1.9176 WP_002853263.1.9194 WP_002853263.1.9231 WP_002853263.1.92325 WP_002853263.1.92449 WP_002853263.1.92465 WP_002853263.1.92637 WP_002853263.1.92761 WP_002853263.1.92983 WP_002853263.1.93020 WP_002853263.1.93029 WP_002853263.1.93057 WP_002853263.1.93214 WP_002853263.1.93549 WP_002853263.1.93575 WP_002853263.1.93632 WP_002853263.1.93654 WP_002853263.1.9372 WP_002853263.1.93864 WP_002853263.1.94467 WP_002853263.1.94534 WP_002853263.1.94535 WP_002853263.1.94631 WP_002853263.1.94660 WP_002853263.1.94802 WP_002853263.1.95048 WP_002853263.1.95065 WP_002853263.1.95087 WP_002853263.1.95360 WP_002853263.1.95773 WP_002853263.1.9582 WP_002853263.1.9591 WP_002853263.1.96104 WP_002853263.1.96265 WP_002853263.1.96291 WP_002853263.1.96302 WP_002853263.1.96501 WP_002853263.1.96525 WP_002853263.1.96527 WP_002853263.1.96616 WP_002853263.1.96886 WP_002853263.1.97085 WP_002853263.1.97120 WP_002853263.1.97174 WP_002853263.1.97347 WP_002853263.1.97629 WP_002853263.1.97790 WP_002853263.1.97809 WP_002853263.1.98210 WP_002853263.1.98367 WP_002853263.1.98476 WP_002853263.1.98782 WP_002853263.1.98885 WP_002853263.1.99003 WP_002853263.1.99021 WP_002853263.1.99042 WP_002853263.1.99079 WP_002853263.1.99085 WP_002853263.1.99129 WP_002853263.1.9920 WP_002853263.1.9929 WP_002853263.1.99440 WP_002853263.1.99444 WP_002853263.1.99612 WP_002853263.1.99673 WP_002853263.1.99811 WP_002853263.1.99893 YP_002344322.1.54668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]