SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6X624 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6X624
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily DsrEFH-like 9.81e-38
Family DsrEF-like 0.00000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B6X624
Sequence length 131
Comment (tr|A0A0B6X624|A0A0B6X624_XENBV) tRNA 2-thiouridine synthesizing protein D {ECO:0000256|HAMAP-Rule:MF_00390} KW=Complete proteome OX=40576 OS=Xenorhabdus bovienii. GN=XBW1_0395 OC=Morganellaceae; Xenorhabdus.
Sequence
MSSLSYCLLVTGPAYGTQQASSAYQFAQALVASGHKLHSVFFYREGVQNGNRLVAPASDE
FDLVRAWQAIAAQHQFNLFICVAAALRRGVTDEQQANELNLSAVNLADGFELSGLGSLAE
AMMLCDRVVQF
Download sequence
Identical sequences A0A077NRL6 A0A077PG84 A0A0B6X624
WP_038195541.1.30251 WP_038195541.1.63801 WP_038195541.1.96151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]