SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6XZG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6XZG3
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily Ras GEF 0.0000392
Family Ras GEF 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B6XZG3
Sequence length 83
Comment (tr|A0A0B6XZG3|A0A0B6XZG3_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK48675.1} OX=1028688 OS=Arion vulgaris. GN=ORF4820 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
GMYKWDKMRSISEIVDQLRIFRDHEYGFQHDTEIQRSLRRCFSEYSEQDLHTVASTQDNN
FRRHPSSTSLSGTLKKVKNILKK
Download sequence
Identical sequences A0A0B6XZG3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]