SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6Y2W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6Y2W4
Domain Number 1 Region: 37-89
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 0.000000000000575
Family E2F dimerization segment 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B6Y2W4
Sequence length 91
Comment (tr|A0A0B6Y2W4|A0A0B6Y2W4_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK50206.1} OX=1028688 OS=Arion vulgaris. GN=ORF10138 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
DITNVLEGIGLIEKKSKNSIQWKGSGPGGNSRDISDRLTSLKNDLADLKEQELEIDKHKQ
WVQQSITNVTDEVTNTRLAFVTYEDICHCFQ
Download sequence
Identical sequences A0A0B6Y2W4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]