SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0B6Y6P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6Y6P2
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily MIR domain 1.03e-21
Family MIR domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B6Y6P2
Sequence length 78
Comment (tr|A0A0B6Y6P2|A0A0B6Y6P2_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK51778.1} OX=1028688 OS=Arion vulgaris. GN=ORF14383 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
YLHSHAHLYPDEYSPKQQQVTSYSHKDDNNKWKIKLADRELGPNEDLIYVHHGDLVRLEH
IATRRNLHSHRELAPISK
Download sequence
Identical sequences A0A0B6Y6P2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]