SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B6ZP55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B6ZP55
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.58e-20
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000432
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B6ZP55
Sequence length 207
Comment (tr|A0A0B6ZP55|A0A0B6ZP55_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK70343.1} OX=1028688 OS=Arion vulgaris. GN=ORF73749 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence
MAATEGLERVVHSLCQSPGIDVNISNDCVKKTPLHILAYKGHIRCVRDLIAAGADINLLD
SESKNPLWYAVANAKRDVTALLLKSNGLVDTYQCPVEHPEHACPVRIAVDKSHIDILKLL
ILSGYDNKHVRECLILPKAHALFSDYQVNYWLQHAQEVTSLRQICRKLIRHHLGIHLFMD
LSKLPLPEKLKSYLLLEELDALVKVSH
Download sequence
Identical sequences A0A0B6ZP55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]